SimulationCraft 902-01

for World of Warcraft 9.0.2.36599 Live (wow build level 36599)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_AshenRemains : 9296 dps, 5032 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9295.6 9295.6 16.2 / 0.174% 765.5 / 8.2% 19.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
408.0 405.0 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_AshenRemains 9296
Cataclysm 777 8.4% 9.6 32.30sec 23962 14105 Direct 28.9 6700 13397 7986 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 28.90 0.00 0.00 1.6990 0.0000 230821.77 230821.77 0.00% 14104.60 14104.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 23.34 13 33 6699.57 6141 7261 6699.96 6536 6946 156373 156373 0.00%
crit 19.23% 5.56 0 12 13397.41 12283 14521 13377.21 0 14366 74449 74449 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.69
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (997) 0.0% (10.7%) 11.8 26.26sec 25139 9290

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.78 0.00 176.08 0.00 2.7059 0.1644 0.00 0.00 0.00% 9290.40 9290.40

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.79
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 997 10.7% 0.0 0.00sec 0 0 Direct 528.2 469 941 561 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 528.23 0.00 0.00 0.0000 0.0000 296252.16 296252.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 425.50 313 561 468.96 263 976 469.12 445 498 199547 199547 0.00%
crit 19.45% 102.73 67 146 941.14 525 1952 942.19 810 1099 96705 96705 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1128 (1497) 12.1% (16.1%) 18.6 15.35sec 23857 11996 Direct 37.1 (73.1) 0 9034 9034 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.63 37.06 0.00 0.00 1.9887 0.0000 334741.22 334741.22 0.00% 11996.49 11996.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.06 28 50 9034.28 5866 12241 9033.97 8804 9293 334741 334741 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.74
  • if_expr:cast_time<havoc_remains
    Internal Combustion 370 4.0% 36.1 15.47sec 3041 0 Direct 36.1 2559 5108 3042 18.9%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.07 36.07 0.00 0.00 0.0000 0.0000 109692.86 109692.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.10% 29.25 18 43 2558.81 1 3715 2562.06 2296 2817 74890 74890 0.00%
crit 18.90% 6.82 0 15 5108.04 7 7430 5114.41 0 6797 34803 34803 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 791 8.5% 36.6 7.95sec 6425 5144 Direct 54.5 3622 7219 4313 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.58 54.49 0.00 0.00 1.2491 0.0000 235043.07 235043.07 0.00% 5143.74 5143.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 44.00 28 60 3622.18 2047 5042 3623.34 3334 3875 159407 159407 0.00%
crit 19.24% 10.48 2 19 7218.87 4095 10084 7215.42 5043 9081 75636 75636 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.67
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.91
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1589 17.1% 25.1 11.31sec 18810 14944 Direct 31.3 1514 3023 1804 19.2%
Periodic 344.2 1014 2030 1209 19.1% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.12 31.35 344.16 344.16 1.2587 2.4818 472568.06 472568.06 0.00% 533.51 14943.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 25.33 15 36 1513.57 820 2017 1514.26 1367 1656 38330 38330 0.00%
crit 19.20% 6.02 1 14 3022.65 1638 4033 3015.91 2076 3890 18197 18197 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.85% 278.27 211 365 1014.38 1 1261 1014.54 991 1037 282280 282280 0.00%
crit 19.15% 65.89 39 94 2029.86 11 2521 2030.38 1896 2133 133761 133761 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.47
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.73
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 554 6.0% 39.2 7.15sec 4213 2989 Direct 49.8 (49.8) 2781 5547 3314 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.19 49.82 0.00 0.00 1.4093 0.0000 165106.74 165106.74 0.00% 2989.33 2989.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 40.21 25 65 2781.36 1315 3426 2782.80 2561 2975 111844 111844 0.00%
crit 19.28% 9.61 2 22 5547.47 2706 6852 5548.36 4071 6523 53263 53263 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.43
    havoc
    [S]:10.95
  • if_expr:cast_time<havoc_remains
Rain of Fire 967 10.4% 18.4 15.66sec 15649 12609 Periodic 435.6 553 1105 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.37 0.00 0.00 435.62 1.2412 0.0000 287459.35 287459.35 0.00% 12608.97 12608.97
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 351.20 225 519 552.81 507 599 552.79 545 560 194142 194142 0.00%
crit 19.38% 84.41 45 126 1105.46 1013 1198 1105.42 1083 1121 93317 93317 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.50
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.87
Scouring Tithe 330 3.6% 13.3 22.40sec 7362 4381 Direct 18.6 1484 2968 1772 19.5%
Periodic 132.4 413 826 492 19.2% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.34 18.64 132.36 132.36 1.6805 2.4556 98201.46 98201.46 0.00% 282.65 4381.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 15.01 7 23 1483.71 1004 1674 1484.31 1365 1618 22266 22266 0.00%
crit 19.47% 3.63 0 9 2967.91 2009 3348 2935.13 0 3348 10773 10773 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.84% 107.00 78 139 413.14 123 419 413.13 410 416 44204 44204 0.00%
crit 19.16% 25.36 9 45 826.37 246 837 826.51 793 837 20959 20959 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.65
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.78
Soul Fire 481 5.2% 5.5 49.49sec 25838 7430 Direct 7.4 16290 32785 19437 19.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.36 0.00 0.00 3.4775 0.0000 142986.69 142986.69 0.00% 7430.20 7430.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 5.96 1 10 16290.19 8599 21175 16356.16 13487 19878 97176 97176 0.00%
crit 18.99% 1.40 0 5 32785.00 17214 42350 25909.70 0 42242 45810 45810 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.73
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.89
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.46sec 12076 10442 Direct 6.0 3348 6696 4022 20.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24152.08 24152.08 0.00% 10441.89 10441.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.77% 4.79 1 6 3348.13 3348 3348 3348.13 3348 3348 16026 16026 0.00%
crit 20.23% 1.21 0 5 6696.27 6696 6696 4984.28 0 6696 8127 8127 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3509 / 717
Immolation 3244 7.1% 39.0 5.49sec 4990 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194617.12 194617.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 94.50 79 107 1395.06 1395 1395 1395.06 1395 1395 131826 131826 0.00%
crit 19.23% 22.50 10 38 2790.11 2790 2790 2790.11 2790 2790 62791 62791 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15901.49 22713.68 29.99% 269.96 269.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 33.16 22 39 325.55 326 326 325.55 326 326 10794 15418 29.99%
crit 19.13% 7.84 2 19 651.10 651 651 651.10 651 651 5108 7296 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.5% 92.6 3.21sec 1650 1134 Direct 91.9 1395 2790 1664 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152833.15 152833.15 0.00% 1133.86 1133.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 74.19 52 97 1395.06 1395 1395 1395.06 1395 1395 103505 103505 0.00%
crit 19.24% 17.68 5 31 2790.11 2790 2790 2790.11 2790 2790 49328 49328 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Kyrian_AshenRemains
Havoc 9.6 32.17sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.56 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.57
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.5sec 54.82% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_AshenRemains
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.2s
  • trigger_min/max:1.9s / 23.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.82%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_AshenRemains
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_AshenRemains_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.1s
  • trigger_min/max:180.0s / 186.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_AshenRemains_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.1s
  • trigger_min/max:180.0s / 186.1s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.88% 7.21% 14.72% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_AshenRemains
soul_fire Soul Shard 6.54 6.84 7.29% 1.04 0.59 7.95%
immolate Soul Shard 344.20 33.16 35.37% 0.10 1.26 3.67%
incinerate Soul Shard 39.21 10.00 10.66% 0.25 0.03 0.30%
conflagrate Soul Shard 36.58 27.24 29.05% 0.74 0.00 0.00%
mana_regen Mana 654.73 120557.51 100.00% 184.13 27974.06 18.83%
immolate_crits Soul Shard 33.06 3.19 3.40% 0.10 0.12 3.58%
incinerate_crits Soul Shard 9.61 0.96 1.02% 0.10 0.00 0.11%
infernal Soul Shard 120.00 10.32 11.01% 0.09 1.68 14.00%
souring_tithe Soul Shard 1.00 2.05 2.19% 2.05 2.95 58.99%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 405.05 408.04 27975.6 49110.2 47687.0 50000.0
Soul Shard 4.0 0.32 0.31 6.6 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_AshenRemains
cataclysm Mana 9.6 4821.0 500.0 500.5 47.9
channel_demonfire Mana 11.8 8841.5 750.0 750.2 33.5
chaos_bolt Soul Shard 18.6 37.2 2.0 2.0 11932.4
conflagrate Mana 36.6 18288.6 500.0 499.9 12.9
havoc Mana 9.6 9569.4 1000.0 1000.5 0.0
immolate Mana 25.1 18832.8 750.0 749.6 25.1
incinerate Mana 39.2 39214.5 1000.0 1000.6 4.2
rain_of_fire Soul Shard 18.4 55.1 3.0 3.0 5218.2
scouring_tithe Mana 13.3 13336.0 1000.0 999.8 7.4
soul_fire Mana 6.5 6544.2 1000.0 1182.5 21.8
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_AshenRemains Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Kyrian_AshenRemains Damage Per Second
Count 618
Mean 9295.58
Minimum 8779.21
Maximum 9947.56
Spread ( max - min ) 1168.36
Range [ ( max - min ) / 2 * 100% ] 6.28%
Standard Deviation 204.8740
5th Percentile 8986.38
95th Percentile 9646.70
( 95th Percentile - 5th Percentile ) 660.32
Mean Distribution
Standard Deviation 8.2412
95.00% Confidence Interval ( 9279.42 - 9311.73 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1867
0.1 Scale Factor Error with Delta=300 359
0.05 Scale Factor Error with Delta=300 1434
0.01 Scale Factor Error with Delta=300 35831
Priority Target DPS
Kyrian_AshenRemains Priority Target Damage Per Second
Count 618
Mean 5032.22
Minimum 4691.85
Maximum 5445.16
Spread ( max - min ) 753.32
Range [ ( max - min ) / 2 * 100% ] 7.48%
Standard Deviation 126.4920
5th Percentile 4847.67
95th Percentile 5249.50
( 95th Percentile - 5th Percentile ) 401.83
Mean Distribution
Standard Deviation 5.0883
95.00% Confidence Interval ( 5022.25 - 5042.20 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2428
0.1 Scale Factor Error with Delta=300 137
0.05 Scale Factor Error with Delta=300 547
0.01 Scale Factor Error with Delta=300 13659
DPS(e)
Kyrian_AshenRemains Damage Per Second (Effective)
Count 618
Mean 9295.58
Minimum 8779.21
Maximum 9947.56
Spread ( max - min ) 1168.36
Range [ ( max - min ) / 2 * 100% ] 6.28%
Damage
Kyrian_AshenRemains Damage
Count 618
Mean 2397025.46
Minimum 1925861.86
Maximum 2905690.14
Spread ( max - min ) 979828.27
Range [ ( max - min ) / 2 * 100% ] 20.44%
DTPS
Kyrian_AshenRemains Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_AshenRemains Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_AshenRemains Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_AshenRemains Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_AshenRemains Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_AshenRemains Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_AshenRemainsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_AshenRemains Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.73 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.69 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.50 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.79 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.47 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.57 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.87 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.67 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.65 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.43 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.91 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.89 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.78 scouring_tithe
Q 7.73 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.74 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 10.95 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFLEDFFJKLDJLJADLHNRSSRQP9EFJILJLJLAHPRNRSQEJILFLJKLFILA9EHNRNPRNQIFLLJELLAIJKHSRSNQR9EFJFIKLAJLHNRRQSNEIKFLMJFFDLAJ9EHPRNRNQDFLJILEKAJLLIHSNRSSNP9FFEFIAJLIHPSNRSNQEFFILJKLJLAIHONRRNPEFFFIJ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.846 cds M summon_infernal Fluffy_Pillow 49673.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.852 aoe H havoc enemy2 49176.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.858 havoc P scouring_tithe Fluffy_Pillow 48679.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.199 havoc R chaos_bolt Fluffy_Pillow 48349.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.206 havoc N conflagrate Fluffy_Pillow 49353.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.211 havoc R chaos_bolt Fluffy_Pillow 49355.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.616 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:12.624 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.631 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:15.039 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.046 aoe D rain_of_fire Fluffy_Pillow 49960.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.052 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:18.058 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:18.996 aoe E channel_demonfire Fluffy_Pillow 48721.0/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust
0:21.242 aoe D rain_of_fire Fluffy_Pillow 49094.0/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust
0:22.248 aoe F immolate enemy2 49597.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust
0:23.256 aoe F immolate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust
0:24.262 aoe J conflagrate Fluffy_Pillow 49006.0/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust
0:25.269 aoe K scouring_tithe Fluffy_Pillow 49009.5/50000: 98% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:26.611 aoe L incinerate Fluffy_Pillow 48680.5/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:27.550 aoe D rain_of_fire Fluffy_Pillow 48150.0/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:28.557 aoe J conflagrate Fluffy_Pillow 48653.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:29.564 aoe L incinerate Fluffy_Pillow 48657.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:30.504 aoe J conflagrate Fluffy_Pillow 48127.0/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:31.510 default A cataclysm Fluffy_Pillow 48130.0/50000: 96% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:33.074 aoe D rain_of_fire Fluffy_Pillow 48412.0/50000: 97% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:34.079 aoe L incinerate Fluffy_Pillow 48914.5/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:35.018 aoe H havoc enemy2 48384.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust
0:36.025 havoc N conflagrate Fluffy_Pillow 47887.5/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust
0:37.033 havoc R chaos_bolt Fluffy_Pillow 47891.5/50000: 96% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:38.443 havoc S incinerate Fluffy_Pillow 48596.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:39.783 havoc S incinerate Fluffy_Pillow 48266.5/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:41.123 havoc R chaos_bolt Fluffy_Pillow 47936.5/50000: 96% mana
2.2/5: 44% soul_shard
0:43.732 havoc Q immolate Fluffy_Pillow 49241.0/50000: 98% mana
0.5/5: 10% soul_shard
0:45.037 havoc P scouring_tithe Fluffy_Pillow 49143.5/50000: 98% mana
0.9/5: 18% soul_shard
0:46.777 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
0:50.254 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:53.078 aoe F immolate enemy3 49664.0/50000: 99% mana
2.8/5: 56% soul_shard
0:54.385 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
0:55.690 aoe I rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
0:56.996 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
0:58.214 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
0:59.521 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:00.741 aoe J conflagrate Fluffy_Pillow 48765.0/50000: 98% mana
2.2/5: 44% soul_shard
1:02.048 aoe L incinerate Fluffy_Pillow 48918.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:03.268 default A cataclysm Fluffy_Pillow 48528.5/50000: 97% mana
3.2/5: 64% soul_shard
1:05.009 aoe H havoc enemy2 48899.0/50000: 98% mana
3.3/5: 66% soul_shard
1:06.323 havoc P scouring_tithe Fluffy_Pillow 48556.0/50000: 97% mana
3.5/5: 70% soul_shard
1:08.064 havoc R chaos_bolt Fluffy_Pillow 48426.5/50000: 97% mana
3.8/5: 76% soul_shard
1:10.674 havoc N conflagrate Fluffy_Pillow 49731.5/50000: 99% mana
2.2/5: 44% soul_shard
1:11.980 havoc R chaos_bolt Fluffy_Pillow 49884.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
1:13.808 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
1:15.547 havoc Q immolate Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
1:16.854 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.3/5: 46% soul_shard
1:19.622 aoe J conflagrate Fluffy_Pillow 49539.0/50000: 99% mana
2.7/5: 54% soul_shard
1:20.929 aoe I rain_of_fire Fluffy_Pillow 49692.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:22.237 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:23.457 aoe F immolate enemy3 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
1:24.763 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.1/5: 22% soul_shard
1:26.504 aoe J conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.6/5: 32% soul_shard
1:27.810 aoe K scouring_tithe Fluffy_Pillow 48929.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:29.551 aoe L incinerate Fluffy_Pillow 48799.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:30.771 aoe F immolate enemy2 48409.5/50000: 97% mana
2.9/5: 58% soul_shard
1:32.076 aoe I rain_of_fire Fluffy_Pillow 48312.0/50000: 97% mana
3.3/5: 66% soul_shard
1:33.381 aoe L incinerate Fluffy_Pillow 48964.5/50000: 98% mana
0.5/5: 10% soul_shard
1:35.121 default A cataclysm Fluffy_Pillow 48834.5/50000: 98% mana
1.0/5: 20% soul_shard
1:36.862 default 9 soul_fire Fluffy_Pillow 49205.0/50000: 98% mana
1.3/5: 26% soul_shard
1:40.339 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
1:43.240 aoe H havoc enemy2 49702.5/50000: 99% mana
3.0/5: 60% soul_shard
1:44.547 havoc N conflagrate Fluffy_Pillow 49356.0/50000: 99% mana
3.1/5: 62% soul_shard
1:45.853 havoc R chaos_bolt Fluffy_Pillow 49509.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:47.681 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:48.987 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:50.728 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
1:52.555 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
2.3/5: 46% soul_shard
1:53.860 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:55.165 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:56.472 aoe F immolate enemy3 49905.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:57.781 aoe L incinerate Fluffy_Pillow 49253.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
1:59.001 aoe L incinerate Fluffy_Pillow 48863.5/50000: 98% mana
1.1/5: 22% soul_shard
2:00.741 aoe J conflagrate Fluffy_Pillow 48733.5/50000: 97% mana
1.6/5: 32% soul_shard
2:02.061 aoe E channel_demonfire Fluffy_Pillow 48893.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:04.876 aoe L incinerate Fluffy_Pillow 49551.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
2:06.097 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.9/5: 58% soul_shard
2:07.838 default A cataclysm Fluffy_Pillow 48873.5/50000: 98% mana
3.3/5: 66% soul_shard
2:09.578 aoe I rain_of_fire Fluffy_Pillow 49243.5/50000: 98% mana
3.5/5: 70% soul_shard
2:10.884 aoe J conflagrate Fluffy_Pillow 49896.5/50000: 100% mana
0.8/5: 16% soul_shard
2:12.189 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
2:13.930 aoe H havoc enemy2 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:15.238 havoc S incinerate Fluffy_Pillow 48656.5/50000: 97% mana
1.7/5: 34% soul_shard
backdraft
2:16.457 havoc R chaos_bolt Fluffy_Pillow 48266.0/50000: 97% mana
2.4/5: 48% soul_shard
2:19.068 havoc S incinerate Fluffy_Pillow 49571.5/50000: 99% mana
0.7/5: 14% soul_shard
2:20.808 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:22.116 havoc Q immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:23.423 havoc R chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:25.248 default 9 soul_fire Fluffy_Pillow 49972.0/50000: 100% mana
0.9/5: 18% soul_shard
2:28.812 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
2:31.643 aoe F immolate enemy3 49667.5/50000: 99% mana
2.8/5: 56% soul_shard
2:32.948 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.8/5: 56% soul_shard
2:34.256 aoe F immolate enemy2 49405.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
2:35.563 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
2:36.868 aoe K scouring_tithe Fluffy_Pillow 49905.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
2:38.609 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
2:39.829 default A cataclysm Fluffy_Pillow 48612.5/50000: 97% mana
1.5/5: 30% soul_shard
2:41.570 aoe J conflagrate Fluffy_Pillow 48983.0/50000: 98% mana
1.5/5: 30% soul_shard
2:42.876 aoe L incinerate Fluffy_Pillow 49136.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:44.095 aoe H havoc enemy2 48745.5/50000: 97% mana
2.5/5: 50% soul_shard
2:45.402 havoc N conflagrate Fluffy_Pillow 48399.0/50000: 97% mana
2.9/5: 58% soul_shard
2:46.708 havoc R chaos_bolt Fluffy_Pillow 48552.0/50000: 97% mana
3.9/5: 78% soul_shard
backdraft
2:48.537 havoc R chaos_bolt Fluffy_Pillow 49466.5/50000: 99% mana
2.3/5: 46% soul_shard
2:51.145 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:52.451 havoc S incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
2:54.193 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
2:55.500 aoe E channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:58.299 aoe I rain_of_fire Fluffy_Pillow 49806.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
2:59.606 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
3:01.343 aoe F immolate enemy3 49000.5/50000: 98% mana
0.4/5: 8% soul_shard
backdraft
3:02.650 aoe L incinerate Fluffy_Pillow 48904.0/50000: 98% mana
0.5/5: 10% soul_shard
backdraft
3:03.869 cds M summon_infernal Fluffy_Pillow 48513.5/50000: 97% mana
0.9/5: 18% soul_shard
3:05.175 aoe J conflagrate Fluffy_Pillow 48166.5/50000: 96% mana
1.2/5: 24% soul_shard
3:06.484 aoe F immolate enemy2 48321.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft
3:07.791 aoe F immolate Fluffy_Pillow 48224.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft
3:09.097 aoe D rain_of_fire Fluffy_Pillow 48127.5/50000: 96% mana
3.0/5: 60% soul_shard
backdraft
3:10.402 aoe L incinerate Fluffy_Pillow 48780.0/50000: 98% mana
0.4/5: 8% soul_shard
backdraft
3:11.620 default A cataclysm Fluffy_Pillow 48389.0/50000: 97% mana
1.0/5: 20% soul_shard
3:13.361 aoe J conflagrate Fluffy_Pillow 48759.5/50000: 98% mana
1.7/5: 34% soul_shard
3:14.667 default 9 soul_fire Fluffy_Pillow 48912.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:18.144 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
3:21.033 aoe H havoc enemy2 49696.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:22.339 havoc P scouring_tithe Fluffy_Pillow 49349.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:24.080 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
3:26.692 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.999 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:29.827 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:31.133 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
3:32.440 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:33.746 aoe F immolate enemy3 49905.5/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
3:35.054 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
3:36.273 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
2.8/5: 56% soul_shard
3:37.579 aoe I rain_of_fire Fluffy_Pillow 49015.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
3:38.887 aoe L incinerate Fluffy_Pillow 49669.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
3:40.108 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
3:43.011 aoe K scouring_tithe Fluffy_Pillow 49704.5/50000: 99% mana
1.4/5: 28% soul_shard
3:44.751 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
3:46.491 aoe J conflagrate Fluffy_Pillow 49372.0/50000: 99% mana
1.8/5: 36% soul_shard
3:47.796 aoe L incinerate Fluffy_Pillow 49524.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
3:49.017 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
3:50.758 aoe I rain_of_fire Fluffy_Pillow 48873.5/50000: 98% mana
3.3/5: 66% soul_shard
3:52.066 aoe H havoc enemy2 49527.5/50000: 99% mana
0.4/5: 8% soul_shard
3:53.372 havoc S incinerate Fluffy_Pillow 49180.5/50000: 98% mana
0.6/5: 12% soul_shard
3:55.114 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
3:56.421 havoc R chaos_bolt Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:58.247 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:59.987 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
4:01.728 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
4:03.147 havoc P scouring_tithe Fluffy_Pillow 49082.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:04.886 default 9 soul_fire Fluffy_Pillow 48951.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:08.362 aoe F immolate enemy3 49001.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
4:09.667 aoe F immolate Fluffy_Pillow 48904.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
4:10.977 aoe E channel_demonfire Fluffy_Pillow 48809.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
4:13.820 aoe F immolate enemy2 49480.5/50000: 99% mana
4.8/5: 96% soul_shard
4:15.127 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
4:16.434 default A cataclysm Fluffy_Pillow 49906.0/50000: 100% mana
2.0/5: 40% soul_shard
4:18.228 aoe J conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
2.4/5: 48% soul_shard
4:19.536 aoe L incinerate Fluffy_Pillow 49656.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
4:20.757 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.4/5: 68% soul_shard
4:22.064 aoe H havoc enemy2 49656.5/50000: 99% mana
0.4/5: 8% soul_shard
4:23.370 havoc P scouring_tithe Fluffy_Pillow 49309.5/50000: 99% mana
0.7/5: 14% soul_shard
4:25.110 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
4:26.849 havoc N conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.5/5: 30% soul_shard
4:28.156 havoc R chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:29.983 havoc S incinerate Fluffy_Pillow 49938.5/50000: 100% mana
1.0/5: 20% soul_shard
4:31.724 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
4:33.031 havoc Q immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:34.339 aoe E channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:37.176 aoe F immolate enemy2 49728.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:38.482 aoe F immolate enemy3 49252.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:39.787 aoe I rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:41.093 aoe L incinerate Fluffy_Pillow 49807.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:42.314 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
4:43.619 aoe K scouring_tithe Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:45.359 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:46.578 aoe J conflagrate Fluffy_Pillow 48611.5/50000: 97% mana
2.4/5: 48% soul_shard
4:47.883 aoe L incinerate Fluffy_Pillow 48764.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:49.103 default A cataclysm Fluffy_Pillow 48374.0/50000: 97% mana
3.4/5: 68% soul_shard
4:50.844 aoe I rain_of_fire Fluffy_Pillow 48744.5/50000: 97% mana
3.5/5: 70% soul_shard
4:52.151 aoe H havoc enemy2 49398.0/50000: 99% mana
1.0/5: 20% soul_shard
4:53.458 havoc O soul_fire Fluffy_Pillow 49051.5/50000: 98% mana
1.0/5: 20% soul_shard
4:56.936 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
4:58.243 havoc R chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
5:00.069 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
5:02.679 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
5:03.987 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
5:05.726 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
5:08.572 aoe F immolate Fluffy_Pillow 49674.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
5:09.878 aoe F immolate enemy3 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
5:11.186 aoe F immolate enemy2 49156.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
5:12.492 aoe I rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
5:13.800 aoe J conflagrate Fluffy_Pillow 49713.0/50000: 99% mana
0.8/5: 16% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_AshenRemains"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=211:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_CombustingEngine : 9334 dps, 5051 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9333.8 9333.8 15.7 / 0.169% 757.0 / 8.1% 19.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
408.0 405.0 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_CombustingEngine 9334
Cataclysm 778 8.3% 9.6 32.39sec 23979 14113 Direct 28.9 6705 13420 7995 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 28.94 0.00 0.00 1.6990 0.0000 231291.55 231291.55 0.00% 14113.47 14113.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 23.39 15 33 6705.38 6142 7261 6705.07 6504 6888 156809 156809 0.00%
crit 19.18% 5.55 0 13 13419.53 12284 14520 13391.03 0 14396 74482 74482 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1000) 0.0% (10.7%) 11.9 25.75sec 25046 9259

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.88 0.00 177.19 0.00 2.7051 0.1643 0.00 0.00 0.00% 9258.86 9258.86

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.88
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1000 10.7% 0.0 0.00sec 0 0 Direct 531.6 469 939 560 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 531.57 0.00 0.00 0.0000 0.0000 297551.88 297551.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 428.82 303 575 468.87 263 976 469.02 440 500 201069 201069 0.00%
crit 19.33% 102.75 62 155 939.03 525 1952 939.46 801 1091 96483 96483 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1063 (1481) 11.4% (15.9%) 18.6 15.60sec 23639 11885 Direct 37.0 (73.1) 0 8527 8527 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.61 37.04 0.00 0.00 1.9890 0.0000 315785.56 315785.56 0.00% 11885.11 11885.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.04 26 50 8526.72 5861 11548 8524.66 8339 8761 315786 315786 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.71
  • if_expr:cast_time<havoc_remains
    Internal Combustion 418 4.5% 36.1 15.69sec 3439 0 Direct 36.1 2887 5817 3439 18.9%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.08 36.08 0.00 0.00 0.0000 0.0000 124058.46 124058.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 29.27 17 47 2886.69 1 4607 2890.95 2531 3293 84470 84470 0.00%
crit 18.87% 6.81 1 16 5816.66 2 9207 5797.07 711 7377 39589 39589 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 793 8.5% 36.6 7.94sec 6446 5161 Direct 54.4 3621 7241 4326 19.5%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.56 54.44 0.00 0.00 1.2490 0.0000 235654.33 235654.33 0.00% 5161.07 5161.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 43.82 32 58 3621.37 2047 5042 3621.75 3395 3846 158653 158653 0.00%
crit 19.51% 10.62 2 23 7240.85 4095 10083 7247.09 5262 8888 77001 77001 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.67
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.89
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1675 18.0% 25.2 11.41sec 19788 15720 Direct 31.4 1516 3024 1810 19.5%
Periodic 344.1 1078 2155 1283 19.0% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.18 31.44 344.07 344.07 1.2588 2.4826 498262.25 498262.25 0.00% 562.45 15719.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 25.31 16 38 1516.00 819 2017 1516.31 1363 1636 38365 38365 0.00%
crit 19.49% 6.13 0 17 3024.25 1638 4033 3012.46 0 3841 18523 18523 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.96% 278.54 215 348 1077.71 0 1714 1077.77 1050 1111 300177 300177 0.00%
crit 19.04% 65.53 41 103 2154.81 1 3429 2155.93 1993 2309 141197 141197 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.50
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 522 5.6% 39.1 7.10sec 3972 2822 Direct 49.8 (49.8) 2622 5244 3117 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.11 49.82 0.00 0.00 1.4073 0.0000 155346.25 155346.25 0.00% 2822.48 2822.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.05% 40.38 25 58 2621.52 1312 3232 2622.62 2423 2805 105823 105823 0.00%
crit 18.95% 9.44 2 21 5244.29 2625 6464 5242.18 4068 6205 49524 49524 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.26
    havoc
    [S]:11.03
  • if_expr:cast_time<havoc_remains
Rain of Fire 967 10.4% 18.4 15.43sec 15631 12594 Periodic 435.5 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.37 0.00 0.00 435.51 1.2412 0.0000 287154.52 287154.52 0.00% 12594.50 12594.50
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 351.70 238 491 552.87 507 599 552.88 547 560 194444 194444 0.00%
crit 19.25% 83.82 44 125 1106.02 1013 1198 1106.12 1082 1125 92710 92710 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.48
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.88
Scouring Tithe 330 3.5% 13.3 22.62sec 7381 4392 Direct 18.7 1480 2981 1764 18.9%
Periodic 132.4 413 826 493 19.3% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.31 18.66 132.42 132.42 1.6804 2.4557 98205.51 98205.51 0.00% 282.57 4392.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 15.13 7 22 1479.83 1004 1674 1480.87 1339 1674 22396 22396 0.00%
crit 18.91% 3.53 0 9 2981.47 2009 3348 2920.72 0 3348 10518 10518 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.66% 106.81 76 144 413.14 123 419 413.12 410 416 44125 44125 0.00%
crit 19.34% 25.61 11 44 826.32 246 837 826.34 801 837 21167 21167 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.67
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.70
Soul Fire 475 5.1% 5.5 49.57sec 25604 7363 Direct 7.3 16298 32100 19279 18.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.33 0.00 0.00 3.4775 0.0000 141441.39 141441.39 0.00% 7362.90 7362.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.10% 5.94 2 10 16297.61 8602 21173 16341.91 13421 19867 96826 96826 0.00%
crit 18.90% 1.39 0 6 32100.49 17288 42298 25481.85 0 42252 44616 44616 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.74
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.88
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.49sec 11989 10367 Direct 6.0 3348 6696 4001 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23978.71 23978.71 0.00% 10366.93 10366.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 4.84 1 6 3348.13 3348 3348 3348.13 3348 3348 16199 16199 0.00%
crit 19.36% 1.16 0 5 6696.27 6696 6696 4919.27 0 6696 7780 7780 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3510 / 717
Immolation 3245 7.0% 39.0 5.49sec 4992 0 Direct 117.0 1395 2790 1664 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194682.58 194682.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 94.45 79 108 1395.06 1395 1395 1395.06 1395 1395 131761 131761 0.00%
crit 19.28% 22.55 9 38 2790.11 2790 2790 2790.11 2790 2790 62922 62922 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15898.33 22709.17 29.99% 269.90 269.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 33.17 23 39 325.55 326 326 325.55 326 326 10797 15422 29.99%
crit 19.11% 7.83 2 18 651.10 651 651 651.10 651 651 5101 7287 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.5% 92.6 3.21sec 1651 1134 Direct 91.9 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152900.87 152900.87 0.00% 1134.36 1134.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 74.15 53 96 1395.06 1395 1395 1395.06 1395 1395 103437 103437 0.00%
crit 19.30% 17.73 6 29 2790.11 2790 2790 2790.11 2790 2790 49464 49464 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Kyrian_CombustingEngine
Havoc 9.6 32.22sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.58
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.5sec 54.81% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.81%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_CombustingEngine_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.5s
  • trigger_min/max:180.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_CombustingEngine_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.5s
  • trigger_min/max:180.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.89% 7.98% 13.91% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_CombustingEngine
soul_fire Soul Shard 6.54 6.93 7.39% 1.06 0.48 6.46%
immolate Soul Shard 344.11 33.11 35.34% 0.10 1.30 3.77%
incinerate Soul Shard 39.11 9.98 10.65% 0.26 0.03 0.31%
conflagrate Soul Shard 36.56 27.22 29.05% 0.74 0.00 0.00%
mana_regen Mana 655.80 120547.46 100.00% 183.82 27973.18 18.83%
immolate_crits Soul Shard 32.87 3.17 3.38% 0.10 0.12 3.63%
incinerate_crits Soul Shard 9.42 0.94 1.00% 0.10 0.00 0.25%
infernal Soul Shard 120.00 10.27 10.96% 0.09 1.73 14.43%
souring_tithe Soul Shard 1.03 2.09 2.23% 2.03 3.06 59.46%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 405.00 408.01 27979.1 49103.9 47744.0 50000.0
Soul Shard 4.0 0.31 0.31 6.7 4.4 0.1 5.0
Usage Type Count Total Avg RPE APR
Kyrian_CombustingEngine
cataclysm Mana 9.7 4827.3 500.0 500.5 47.9
channel_demonfire Mana 11.9 8912.5 750.0 750.2 33.4
chaos_bolt Soul Shard 18.6 37.2 2.0 2.0 11826.2
conflagrate Mana 36.6 18277.6 500.0 500.0 12.9
havoc Mana 9.6 9578.9 1000.0 1000.6 0.0
immolate Mana 25.2 18896.7 750.0 750.5 26.4
incinerate Mana 39.1 39108.8 1000.0 1000.0 4.0
rain_of_fire Soul Shard 18.4 55.1 3.0 3.0 5211.3
scouring_tithe Mana 13.3 13304.4 1000.0 999.9 7.4
soul_fire Mana 6.5 6536.3 1000.0 1183.2 21.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_CombustingEngine Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Kyrian_CombustingEngine Damage Per Second
Count 618
Mean 9333.79
Minimum 8866.38
Maximum 9886.77
Spread ( max - min ) 1020.39
Range [ ( max - min ) / 2 * 100% ] 5.47%
Standard Deviation 199.6813
5th Percentile 9036.26
95th Percentile 9687.89
( 95th Percentile - 5th Percentile ) 651.63
Mean Distribution
Standard Deviation 8.0324
95.00% Confidence Interval ( 9318.05 - 9349.54 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1759
0.1 Scale Factor Error with Delta=300 341
0.05 Scale Factor Error with Delta=300 1362
0.01 Scale Factor Error with Delta=300 34038
Priority Target DPS
Kyrian_CombustingEngine Priority Target Damage Per Second
Count 618
Mean 5050.59
Minimum 4752.42
Maximum 5431.81
Spread ( max - min ) 679.40
Range [ ( max - min ) / 2 * 100% ] 6.73%
Standard Deviation 119.4622
5th Percentile 4865.68
95th Percentile 5253.85
( 95th Percentile - 5th Percentile ) 388.17
Mean Distribution
Standard Deviation 4.8055
95.00% Confidence Interval ( 5041.17 - 5060.01 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2150
0.1 Scale Factor Error with Delta=300 122
0.05 Scale Factor Error with Delta=300 488
0.01 Scale Factor Error with Delta=300 12183
DPS(e)
Kyrian_CombustingEngine Damage Per Second (Effective)
Count 618
Mean 9333.79
Minimum 8866.38
Maximum 9886.77
Spread ( max - min ) 1020.39
Range [ ( max - min ) / 2 * 100% ] 5.47%
Damage
Kyrian_CombustingEngine Damage
Count 618
Mean 2408730.40
Minimum 1951386.39
Maximum 2934036.58
Spread ( max - min ) 982650.19
Range [ ( max - min ) / 2 * 100% ] 20.40%
DTPS
Kyrian_CombustingEngine Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_CombustingEngine Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_CombustingEngine Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_CombustingEngine Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_CombustingEngine Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_CombustingEngine Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_CombustingEngineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_CombustingEngine Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.74 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.48 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.88 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.50 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.58 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.88 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.67 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.67 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.26 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.89 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.88 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.70 scouring_tithe
Q 7.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.71 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.03 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKDLJLJADLEHNRSRONFFIKELJLIAJLHNRSPQSNEIFLJLILL9AHNPRNRSQEFIJFLJKLLILAHNRSSNQP9EFIJLIJLLLAHNPRRSNQEFLFMDJKLD9AHNRNRRNPDFEFFJLILJLLAHPNRSRQN9EFIJKLLIJAHSSRSNQPEILJFLJILLL9AEHNPRNRQNIL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.072 cds M summon_infernal Fluffy_Pillow 49786.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.079 aoe H havoc enemy2 49289.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.086 havoc P scouring_tithe Fluffy_Pillow 48793.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.426 havoc R chaos_bolt Fluffy_Pillow 48463.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.434 havoc N conflagrate Fluffy_Pillow 49467.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.443 havoc R chaos_bolt Fluffy_Pillow 49471.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.848 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.855 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.863 havoc R chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:15.268 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.275 aoe D rain_of_fire Fluffy_Pillow 49959.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.282 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:18.291 aoe E channel_demonfire Fluffy_Pillow 49253.5/50000: 99% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:20.770 aoe D rain_of_fire Fluffy_Pillow 49743.0/50000: 99% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:21.775 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:22.714 aoe F immolate enemy2 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust
0:23.722 aoe F immolate Fluffy_Pillow 48756.0/50000: 98% mana
1.4/5: 28% soul_shard
bloodlust
0:24.730 aoe J conflagrate Fluffy_Pillow 48510.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:25.737 aoe K scouring_tithe Fluffy_Pillow 48513.5/50000: 97% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:27.077 aoe D rain_of_fire Fluffy_Pillow 48183.5/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:28.082 aoe L incinerate Fluffy_Pillow 48686.0/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:29.020 aoe J conflagrate Fluffy_Pillow 48155.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:30.026 aoe L incinerate Fluffy_Pillow 48158.0/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:30.965 aoe J conflagrate Fluffy_Pillow 47627.5/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust
0:31.972 default A cataclysm Fluffy_Pillow 47631.0/50000: 95% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:33.313 aoe D rain_of_fire Fluffy_Pillow 47801.5/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:34.319 aoe L incinerate Fluffy_Pillow 48304.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:35.258 aoe E channel_demonfire Fluffy_Pillow 47774.0/50000: 96% mana
1.5/5: 30% soul_shard
bloodlust
0:37.505 aoe H havoc enemy2 48147.5/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust
0:38.512 havoc N conflagrate Fluffy_Pillow 47651.0/50000: 95% mana
2.1/5: 42% soul_shard
bloodlust
0:39.519 havoc R chaos_bolt Fluffy_Pillow 47654.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:40.927 havoc S incinerate Fluffy_Pillow 48358.5/50000: 97% mana
1.4/5: 28% soul_shard
bloodlust
0:42.270 havoc R chaos_bolt Fluffy_Pillow 48030.0/50000: 96% mana
2.1/5: 42% soul_shard
0:44.879 havoc O soul_fire Fluffy_Pillow 49334.5/50000: 99% mana
0.4/5: 8% soul_shard
0:48.479 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
0:49.787 aoe F immolate Fluffy_Pillow 49157.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
0:51.092 aoe F immolate enemy3 49059.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
0:52.399 aoe I rain_of_fire Fluffy_Pillow 48963.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
0:53.706 aoe K scouring_tithe Fluffy_Pillow 49616.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
0:55.448 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
0:58.338 aoe L incinerate Fluffy_Pillow 49698.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
0:59.557 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
1:00.861 aoe L incinerate Fluffy_Pillow 49154.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:02.082 aoe I rain_of_fire Fluffy_Pillow 48764.5/50000: 98% mana
3.0/5: 60% soul_shard
1:03.390 default A cataclysm Fluffy_Pillow 49418.5/50000: 99% mana
0.3/5: 6% soul_shard
1:05.133 aoe J conflagrate Fluffy_Pillow 49503.5/50000: 99% mana
0.3/5: 6% soul_shard
1:06.441 aoe L incinerate Fluffy_Pillow 49657.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:07.661 aoe H havoc enemy2 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:08.968 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
1.7/5: 34% soul_shard
1:10.463 havoc R chaos_bolt Fluffy_Pillow 48903.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:12.291 havoc S incinerate Fluffy_Pillow 49817.5/50000: 100% mana
1.0/5: 20% soul_shard
1:14.032 havoc P scouring_tithe Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
1:15.773 havoc Q immolate Fluffy_Pillow 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
1:17.079 havoc S incinerate Fluffy_Pillow 48776.0/50000: 98% mana
2.1/5: 42% soul_shard
1:18.820 havoc N conflagrate Fluffy_Pillow 48646.5/50000: 97% mana
2.9/5: 58% soul_shard
1:20.126 aoe E channel_demonfire Fluffy_Pillow 48799.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:23.009 aoe I rain_of_fire Fluffy_Pillow 49491.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:24.316 aoe F immolate enemy3 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
1:25.623 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
1:26.843 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
2.1/5: 42% soul_shard
1:28.151 aoe L incinerate Fluffy_Pillow 49016.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:29.370 aoe I rain_of_fire Fluffy_Pillow 48626.0/50000: 97% mana
3.1/5: 62% soul_shard
1:30.677 aoe L incinerate Fluffy_Pillow 49279.5/50000: 99% mana
0.1/5: 2% soul_shard
1:32.418 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
1:34.159 default 9 soul_fire Fluffy_Pillow 48873.0/50000: 98% mana
1.0/5: 20% soul_shard
1:37.637 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
1:39.379 aoe H havoc enemy2 49373.5/50000: 99% mana
2.8/5: 56% soul_shard
1:40.685 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
2.9/5: 58% soul_shard
1:41.991 havoc P scouring_tithe Fluffy_Pillow 49179.5/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
1:43.730 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
1:45.558 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
2.6/5: 52% soul_shard
1:46.865 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:48.692 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
1:50.431 havoc Q immolate Fluffy_Pillow 49001.5/50000: 98% mana
2.7/5: 54% soul_shard
1:51.738 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.7/5: 54% soul_shard
1:54.581 aoe F immolate enemy2 49576.5/50000: 99% mana
2.9/5: 58% soul_shard
1:55.888 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
1:57.195 aoe J conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
0.1/5: 2% soul_shard
1:58.500 aoe F immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:59.806 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
2:01.026 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.3/5: 26% soul_shard
2:02.356 aoe K scouring_tithe Fluffy_Pillow 49027.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:04.098 aoe L incinerate Fluffy_Pillow 48898.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:05.319 aoe L incinerate Fluffy_Pillow 48508.5/50000: 97% mana
2.5/5: 50% soul_shard
2:07.059 aoe I rain_of_fire Fluffy_Pillow 48378.5/50000: 97% mana
3.0/5: 60% soul_shard
2:08.364 aoe L incinerate Fluffy_Pillow 49031.0/50000: 98% mana
0.2/5: 4% soul_shard
2:10.103 default A cataclysm Fluffy_Pillow 48900.5/50000: 98% mana
0.6/5: 12% soul_shard
2:11.843 aoe H havoc enemy2 49270.5/50000: 99% mana
0.9/5: 18% soul_shard
2:13.149 havoc N conflagrate Fluffy_Pillow 48923.5/50000: 98% mana
1.0/5: 20% soul_shard
2:14.455 havoc R chaos_bolt Fluffy_Pillow 49076.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:16.282 havoc S incinerate Fluffy_Pillow 49990.0/50000: 100% mana
0.4/5: 8% soul_shard
2:18.021 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
2:19.762 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
2:21.070 havoc Q immolate Fluffy_Pillow 49026.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:22.376 havoc P scouring_tithe Fluffy_Pillow 48929.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:24.117 default 9 soul_fire Fluffy_Pillow 48799.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:27.593 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
2:30.407 aoe F immolate enemy3 49658.5/50000: 99% mana
5.0/5: 100% soul_shard
2:31.714 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
2:33.020 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.3/5: 46% soul_shard
2:34.327 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
2:35.547 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.3/5: 66% soul_shard
2:36.854 aoe J conflagrate Fluffy_Pillow 49656.0/50000: 99% mana
0.4/5: 8% soul_shard
2:38.160 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:39.378 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
2:41.117 aoe L incinerate Fluffy_Pillow 48871.0/50000: 98% mana
1.8/5: 36% soul_shard
2:42.857 default A cataclysm Fluffy_Pillow 48741.0/50000: 97% mana
2.3/5: 46% soul_shard
2:44.597 aoe H havoc enemy2 49111.0/50000: 98% mana
2.5/5: 50% soul_shard
2:45.904 havoc N conflagrate Fluffy_Pillow 48764.5/50000: 98% mana
2.7/5: 54% soul_shard
2:47.213 havoc P scouring_tithe Fluffy_Pillow 48919.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
2:48.954 havoc R chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
2:50.782 havoc R chaos_bolt Fluffy_Pillow 49703.5/50000: 99% mana
2.2/5: 44% soul_shard
2:53.392 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:55.132 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:56.437 havoc Q immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:57.744 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:00.513 aoe F immolate enemy2 49692.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
3:01.819 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:03.040 aoe F immolate enemy3 48862.5/50000: 98% mana
3.1/5: 62% soul_shard
3:04.347 cds M summon_infernal Fluffy_Pillow 48766.0/50000: 98% mana
3.2/5: 64% soul_shard
3:05.654 aoe D rain_of_fire Fluffy_Pillow 48419.5/50000: 97% mana
3.6/5: 72% soul_shard
3:06.962 aoe J conflagrate Fluffy_Pillow 49073.5/50000: 98% mana
1.0/5: 20% soul_shard
3:08.269 aoe K scouring_tithe Fluffy_Pillow 49227.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:10.010 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:11.229 aoe D rain_of_fire Fluffy_Pillow 48612.0/50000: 97% mana
3.0/5: 60% soul_shard
3:12.535 default 9 soul_fire Fluffy_Pillow 49265.0/50000: 99% mana
0.6/5: 12% soul_shard
3:16.068 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
3:17.808 aoe H havoc enemy2 49372.5/50000: 99% mana
3.3/5: 66% soul_shard
3:19.114 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
3.7/5: 74% soul_shard
3:20.420 havoc R chaos_bolt Fluffy_Pillow 49178.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:22.246 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.551 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:25.380 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.989 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
3:29.294 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
3:31.033 aoe D rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
3:32.339 aoe F immolate Fluffy_Pillow 49654.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
3:33.645 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:36.486 aoe F immolate enemy3 49922.5/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
3:37.793 aoe F immolate enemy2 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
3:39.101 aoe J conflagrate Fluffy_Pillow 49156.5/50000: 98% mana
2.0/5: 40% soul_shard
3:40.407 aoe L incinerate Fluffy_Pillow 49309.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
3:41.626 aoe I rain_of_fire Fluffy_Pillow 48919.0/50000: 98% mana
3.0/5: 60% soul_shard
3:42.933 aoe L incinerate Fluffy_Pillow 49572.5/50000: 99% mana
0.1/5: 2% soul_shard
3:44.674 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.6/5: 12% soul_shard
3:46.145 aoe L incinerate Fluffy_Pillow 49238.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:47.365 aoe L incinerate Fluffy_Pillow 48848.0/50000: 98% mana
1.6/5: 32% soul_shard
3:49.103 default A cataclysm Fluffy_Pillow 48717.0/50000: 97% mana
1.8/5: 36% soul_shard
3:50.843 aoe H havoc enemy2 49087.0/50000: 98% mana
2.2/5: 44% soul_shard
3:52.149 havoc P scouring_tithe Fluffy_Pillow 48740.0/50000: 97% mana
2.5/5: 50% soul_shard
3:53.889 havoc N conflagrate Fluffy_Pillow 48610.0/50000: 97% mana
2.5/5: 50% soul_shard
3:55.195 havoc R chaos_bolt Fluffy_Pillow 48763.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
3:57.021 havoc S incinerate Fluffy_Pillow 49676.0/50000: 99% mana
1.8/5: 36% soul_shard
3:58.760 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.6/5: 52% soul_shard
4:01.369 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:02.677 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
4:03.982 default 9 soul_fire Fluffy_Pillow 49405.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:07.460 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:10.343 aoe F immolate enemy3 49694.0/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
4:11.650 aoe I rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:12.956 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
1.4/5: 28% soul_shard
4:14.262 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:16.003 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:17.222 aoe L incinerate Fluffy_Pillow 48612.0/50000: 97% mana
2.5/5: 50% soul_shard
4:18.963 aoe I rain_of_fire Fluffy_Pillow 48482.5/50000: 97% mana
3.0/5: 60% soul_shard
4:20.268 aoe J conflagrate Fluffy_Pillow 49135.0/50000: 98% mana
0.0/5: 0% soul_shard
4:21.574 default A cataclysm Fluffy_Pillow 49288.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:23.314 aoe H havoc enemy2 49502.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
4:24.621 havoc S incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:25.840 havoc S incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
4:27.580 havoc R chaos_bolt Fluffy_Pillow 48635.0/50000: 97% mana
2.5/5: 50% soul_shard
4:30.189 havoc S incinerate Fluffy_Pillow 49939.5/50000: 100% mana
0.9/5: 18% soul_shard
4:31.930 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
4:33.234 havoc Q immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:34.540 havoc P scouring_tithe Fluffy_Pillow 49057.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:36.281 aoe E channel_demonfire Fluffy_Pillow 48928.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:39.130 aoe I rain_of_fire Fluffy_Pillow 49602.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
4:40.436 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
4:41.654 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
4:42.961 aoe F immolate enemy3 49155.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:44.268 aoe L incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:45.487 aoe J conflagrate Fluffy_Pillow 48668.0/50000: 97% mana
2.2/5: 44% soul_shard
4:46.795 aoe I rain_of_fire Fluffy_Pillow 48822.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:48.101 aoe L incinerate Fluffy_Pillow 49475.0/50000: 99% mana
0.0/5: 0% soul_shard
backdraft
4:49.321 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.4/5: 8% soul_shard
4:51.062 aoe L incinerate Fluffy_Pillow 48873.0/50000: 98% mana
0.7/5: 14% soul_shard
4:52.804 default 9 soul_fire Fluffy_Pillow 48744.0/50000: 97% mana
1.3/5: 26% soul_shard
4:56.282 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
4:58.023 aoe E channel_demonfire Fluffy_Pillow 49373.0/50000: 99% mana
2.9/5: 58% soul_shard
5:00.877 aoe H havoc enemy2 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
5:02.184 havoc N conflagrate Fluffy_Pillow 49653.5/50000: 99% mana
3.2/5: 64% soul_shard
5:03.491 havoc P scouring_tithe Fluffy_Pillow 49807.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
5:05.230 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
5:07.058 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
2.8/5: 56% soul_shard
5:08.364 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
backdraft
5:10.190 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
5:11.495 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.4/5: 48% soul_shard
5:12.802 aoe I rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
5:14.107 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_CombustingEngine"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=212:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_DuplicitousHavoc : 9398 dps, 4975 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9398.2 9398.2 16.5 / 0.175% 788.3 / 8.4% 20.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.8 404.9 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_DuplicitousHavoc 9398
Cataclysm 780 8.3% 9.6 32.32sec 24075 14171 Direct 28.9 6705 13408 8024 19.7%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 28.89 0.00 0.00 1.6990 0.0000 231864.14 231864.14 0.00% 14170.89 14170.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 23.21 14 32 6705.36 6142 7261 6705.59 6523 6880 155605 155605 0.00%
crit 19.69% 5.69 0 13 13408.09 12283 14521 13362.85 0 14466 76259 76259 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.71
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1001) 0.0% (10.7%) 11.9 26.21sec 25077 9267

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 0.00 177.30 0.00 2.7059 0.1643 0.00 0.00 0.00% 9267.44 9267.44

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.88
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1001 10.7% 0.0 0.00sec 0 0 Direct 531.9 469 940 560 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 531.89 0.00 0.00 0.0000 0.0000 297716.50 297716.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 429.47 303 562 468.96 263 976 469.05 447 493 201378 201378 0.00%
crit 19.26% 102.42 66 150 940.32 525 1952 940.86 791 1085 96339 96339 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1168 (1539) 12.4% (16.4%) 18.7 15.28sec 24467 12316 Direct 37.2 (73.4) 0 9335 9335 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.69 37.17 0.00 0.00 1.9865 0.0000 346967.09 346967.09 0.00% 12316.37 12316.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.17 26 50 9335.38 7326 11548 9334.20 9085 9562 346967 346967 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.79
  • if_expr:cast_time<havoc_remains
    Internal Combustion 371 3.9% 36.2 15.41sec 3046 0 Direct 36.2 2560 5125 3047 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.18 36.18 0.00 0.00 0.0000 0.0000 110216.62 110216.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 29.32 19 44 2559.88 1 3715 2563.03 2227 2853 75074 75074 0.00%
crit 18.96% 6.86 1 14 5125.27 2 7430 5127.50 1259 6740 35142 35142 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 837 8.9% 36.6 7.97sec 6800 5444 Direct 54.5 3818 7675 4562 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.56 54.50 0.00 0.00 1.2491 0.0000 248653.08 248653.08 0.00% 5444.32 5444.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 44.00 30 58 3818.28 2559 5042 3818.05 3593 4052 168000 168000 0.00%
crit 19.28% 10.51 3 22 7674.85 5118 10084 7668.06 6352 8917 80653 80653 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.61
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.95
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1599 17.0% 25.2 11.36sec 18916 15028 Direct 31.4 1569 3130 1867 19.1%
Periodic 344.3 1015 2029 1212 19.4% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.15 31.41 344.29 344.29 1.2588 2.4819 475756.22 475756.22 0.00% 536.87 15027.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 25.42 16 36 1569.36 1024 2017 1569.32 1457 1671 39894 39894 0.00%
crit 19.07% 5.99 0 15 3129.67 2051 4033 3126.75 0 3892 18749 18749 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.61% 277.53 211 348 1014.88 0 1261 1014.95 985 1040 281652 281652 0.00%
crit 19.39% 66.76 43 97 2029.07 2 2521 2029.30 1916 2122 135461 135461 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.47
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 541 5.8% 39.1 7.16sec 4120 2925 Direct 49.7 (49.7) 2715 5444 3241 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.10 49.69 0.00 0.00 1.4085 0.0000 161063.30 161063.30 0.00% 2925.02 2925.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 40.10 25 60 2714.62 1640 3232 2716.49 2556 2905 108883 108883 0.00%
crit 19.30% 9.59 2 21 5443.63 3282 6464 5441.98 4366 6315 52180 52180 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.37
    havoc
    [S]:10.91
  • if_expr:cast_time<havoc_remains
Rain of Fire 966 10.3% 18.3 15.68sec 15673 12630 Periodic 434.7 553 1106 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.30 0.00 0.00 434.67 1.2409 0.0000 286811.06 286811.06 0.00% 12630.40 12630.40
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 350.66 247 495 553.00 507 599 552.99 545 560 193912 193912 0.00%
crit 19.33% 84.01 48 128 1105.80 1013 1198 1105.72 1085 1126 92899 92899 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.46
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.84
Scouring Tithe 336 3.6% 13.3 22.50sec 7506 4467 Direct 18.6 1555 3105 1862 19.9%
Periodic 132.2 413 827 493 19.2% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.30 18.61 132.24 132.24 1.6804 2.4555 99819.29 99819.29 0.00% 287.62 4467.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.13% 14.91 5 23 1555.38 1256 1674 1555.88 1477 1639 23186 23186 0.00%
crit 19.87% 3.70 0 10 3105.39 2511 3348 3022.66 0 3348 11481 11481 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.76% 106.79 66 148 413.12 123 419 413.10 410 417 44118 44118 0.00%
crit 19.24% 25.44 9 46 826.54 246 837 826.64 790 837 21033 21033 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.69
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.69
Soul Fire 488 5.2% 5.5 49.34sec 26366 7582 Direct 7.3 16533 33195 19800 19.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.51 7.34 0.00 0.00 3.4775 0.0000 145269.04 145269.04 0.00% 7581.89 7581.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 5.91 2 10 16533.39 10749 21170 16568.91 13913 19659 97724 97724 0.00%
crit 19.52% 1.43 0 5 33194.61 21628 42344 25891.19 0 42244 47545 47545 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.71
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.89
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.60sec 12073 10444 Direct 6.0 3348 6696 4032 20.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24146.66 24146.66 0.00% 10444.06 10444.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.80% 4.79 1 6 3348.13 3348 3348 3348.13 3348 3348 16031 16031 0.00%
crit 20.20% 1.21 0 5 6696.27 6696 6696 4962.61 0 6696 8116 8116 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3503 / 716
Immolation 3237 7.0% 39.0 5.49sec 4981 0 Direct 117.0 1395 2790 1660 19.0%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194240.14 194240.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 94.77 83 107 1395.06 1395 1395 1395.06 1395 1395 132203 132203 0.00%
crit 19.00% 22.23 10 34 2790.11 2790 2790 2790.11 2790 2790 62037 62037 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 390 271 Direct 41.0 326 651 390 19.7%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15975.24 22819.03 29.99% 271.21 271.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 32.93 26 40 325.55 326 326 325.55 326 326 10720 15313 29.99%
crit 19.69% 8.07 1 15 651.10 651 651 651.10 651 651 5255 7507 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.5% 92.6 3.21sec 1648 1132 Direct 91.9 1395 2790 1662 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152632.25 152632.25 0.00% 1132.36 1132.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 74.34 55 96 1395.06 1395 1395 1395.06 1395 1395 103706 103706 0.00%
crit 19.09% 17.54 6 29 2790.11 2790 2790 2790.11 2790 2790 48926 48926 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Kyrian_DuplicitousHavoc
Havoc 9.6 32.11sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.57
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.4sec 54.66% 0.00% 0.0 (0.0) 3.0

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.7s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.66%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.2s
  • trigger_min/max:180.0s / 184.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.2s
  • trigger_min/max:180.0s / 184.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.94% 7.57% 14.12% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_DuplicitousHavoc
soul_fire Soul Shard 6.52 6.84 7.31% 1.05 0.56 7.54%
immolate Soul Shard 344.38 33.13 35.37% 0.10 1.31 3.81%
incinerate Soul Shard 39.10 9.96 10.64% 0.25 0.03 0.29%
conflagrate Soul Shard 36.56 27.25 29.10% 0.75 0.00 0.00%
mana_regen Mana 655.54 120507.16 100.00% 183.83 28004.43 18.86%
immolate_crits Soul Shard 33.65 3.25 3.47% 0.10 0.11 3.36%
incinerate_crits Soul Shard 9.58 0.96 1.02% 0.10 0.00 0.18%
infernal Soul Shard 120.00 10.26 10.95% 0.09 1.74 14.51%
souring_tithe Soul Shard 0.97 1.99 2.13% 2.06 2.86 58.89%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.89 407.76 28001.0 49146.5 47479.5 50000.0
Soul Shard 4.0 0.31 0.31 6.6 4.4 0.1 5.0
Usage Type Count Total Avg RPE APR
Kyrian_DuplicitousHavoc
cataclysm Mana 9.6 4820.2 500.0 500.5 48.1
channel_demonfire Mana 11.9 8907.7 750.0 750.3 33.4
chaos_bolt Soul Shard 18.7 37.4 2.0 2.0 12238.4
conflagrate Mana 36.6 18281.5 500.0 500.0 13.6
havoc Mana 9.6 9571.0 1000.0 1000.3 0.0
immolate Mana 25.2 18865.9 750.0 750.1 25.2
incinerate Mana 39.1 39102.5 1000.0 1000.2 4.1
rain_of_fire Soul Shard 18.3 54.9 3.0 3.0 5225.2
scouring_tithe Mana 13.3 13293.4 1000.0 999.7 7.5
soul_fire Mana 6.5 6518.9 1000.0 1183.2 22.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Kyrian_DuplicitousHavoc Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Kyrian_DuplicitousHavoc Damage Per Second
Count 618
Mean 9398.21
Minimum 8898.29
Maximum 9951.21
Spread ( max - min ) 1052.92
Range [ ( max - min ) / 2 * 100% ] 5.60%
Standard Deviation 208.6922
5th Percentile 9081.20
95th Percentile 9756.82
( 95th Percentile - 5th Percentile ) 675.63
Mean Distribution
Standard Deviation 8.3948
95.00% Confidence Interval ( 9381.75 - 9414.66 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1895
0.1 Scale Factor Error with Delta=300 372
0.05 Scale Factor Error with Delta=300 1488
0.01 Scale Factor Error with Delta=300 37179
Priority Target DPS
Kyrian_DuplicitousHavoc Priority Target Damage Per Second
Count 618
Mean 4974.78
Minimum 4629.42
Maximum 5374.60
Spread ( max - min ) 745.18
Range [ ( max - min ) / 2 * 100% ] 7.49%
Standard Deviation 125.3463
5th Percentile 4786.98
95th Percentile 5183.06
( 95th Percentile - 5th Percentile ) 396.08
Mean Distribution
Standard Deviation 5.0422
95.00% Confidence Interval ( 4964.90 - 4984.66 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2439
0.1 Scale Factor Error with Delta=300 135
0.05 Scale Factor Error with Delta=300 537
0.01 Scale Factor Error with Delta=300 13413
DPS(e)
Kyrian_DuplicitousHavoc Damage Per Second (Effective)
Count 618
Mean 9398.21
Minimum 8898.29
Maximum 9951.21
Spread ( max - min ) 1052.92
Range [ ( max - min ) / 2 * 100% ] 5.60%
Damage
Kyrian_DuplicitousHavoc Damage
Count 618
Mean 2428283.00
Minimum 1935774.63
Maximum 2951014.67
Spread ( max - min ) 1015240.04
Range [ ( max - min ) / 2 * 100% ] 20.90%
DTPS
Kyrian_DuplicitousHavoc Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_DuplicitousHavoc Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_DuplicitousHavoc Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_DuplicitousHavoc Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_DuplicitousHavoc Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_DuplicitousHavoc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_DuplicitousHavocTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_DuplicitousHavoc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.71 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.71 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.46 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.88 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.47 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.57 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.84 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.61 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.69 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.37 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.95 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.89 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.69 scouring_tithe
Q 7.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.79 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 10.91 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFEDLFFJKDLJLJADLEHNRSRNPS9FFEFIJLAJIHPSNRSSNEFFFILJKLLAI9EHNRNPRNQFILLJELAIJKLHRSNQRS9EFIJKLAJLJHRSRNQRPEFJFFMLDJAL9HPRNRNRQDEFFJKLIAJLHSRSNQRPE9FFIJLJALHNPRRQNELLFIFJKFLJLAHRNOREIJKLFLJLF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.069 cds M summon_infernal Fluffy_Pillow 49784.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.077 aoe H havoc enemy2 49288.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.085 havoc P scouring_tithe Fluffy_Pillow 48792.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.425 havoc R chaos_bolt Fluffy_Pillow 48462.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.432 havoc N conflagrate Fluffy_Pillow 49466.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.439 havoc R chaos_bolt Fluffy_Pillow 49469.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.845 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.852 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.859 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, backdraft
0:15.265 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.272 aoe D rain_of_fire Fluffy_Pillow 49959.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.278 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.286 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:20.633 aoe D rain_of_fire Fluffy_Pillow 49676.5/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:21.637 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:22.577 aoe F immolate enemy2 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust
0:23.585 aoe F immolate Fluffy_Pillow 48756.5/50000: 98% mana
1.3/5: 26% soul_shard
bloodlust
0:24.592 aoe J conflagrate Fluffy_Pillow 48510.0/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust
0:25.599 aoe K scouring_tithe Fluffy_Pillow 48513.5/50000: 97% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:26.940 aoe D rain_of_fire Fluffy_Pillow 48184.0/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:27.946 aoe L incinerate Fluffy_Pillow 48687.0/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:28.885 aoe J conflagrate Fluffy_Pillow 48156.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust
0:29.893 aoe L incinerate Fluffy_Pillow 48160.5/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:30.832 aoe J conflagrate Fluffy_Pillow 47630.0/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust
0:31.838 default A cataclysm Fluffy_Pillow 47633.0/50000: 95% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:33.179 aoe D rain_of_fire Fluffy_Pillow 47803.5/50000: 96% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:34.187 aoe L incinerate Fluffy_Pillow 48307.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:35.128 aoe E channel_demonfire Fluffy_Pillow 47778.0/50000: 96% mana
1.5/5: 30% soul_shard
bloodlust
0:37.413 aoe H havoc enemy2 48170.5/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust
0:38.419 havoc N conflagrate Fluffy_Pillow 47673.5/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust
0:39.425 havoc R chaos_bolt Fluffy_Pillow 47676.5/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:40.830 havoc S incinerate Fluffy_Pillow 48379.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust
0:42.171 havoc R chaos_bolt Fluffy_Pillow 48049.5/50000: 96% mana
2.5/5: 50% soul_shard
0:44.781 havoc N conflagrate Fluffy_Pillow 49354.5/50000: 99% mana
1.0/5: 20% soul_shard
0:46.087 havoc P scouring_tithe Fluffy_Pillow 49507.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
0:47.828 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
0:49.049 default 9 soul_fire Fluffy_Pillow 48613.0/50000: 97% mana
2.5/5: 50% soul_shard
0:52.527 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
0:53.835 aoe F immolate enemy2 48906.5/50000: 98% mana
3.9/5: 78% soul_shard
0:55.141 aoe E channel_demonfire Fluffy_Pillow 48809.5/50000: 98% mana
4.0/5: 80% soul_shard
0:57.933 aoe F immolate enemy3 49455.5/50000: 99% mana
4.3/5: 86% soul_shard
0:59.238 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
1:00.544 aoe J conflagrate Fluffy_Pillow 49904.5/50000: 100% mana
1.6/5: 32% soul_shard
1:01.850 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
1:03.069 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
1:04.915 aoe J conflagrate Fluffy_Pillow 49425.0/50000: 99% mana
2.9/5: 58% soul_shard
1:06.221 aoe I rain_of_fire Fluffy_Pillow 49578.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:07.527 aoe H havoc enemy2 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
1:08.834 havoc P scouring_tithe Fluffy_Pillow 49653.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
1:10.572 havoc S incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
1:11.791 havoc N conflagrate Fluffy_Pillow 48610.5/50000: 97% mana
1.5/5: 30% soul_shard
1:13.097 havoc R chaos_bolt Fluffy_Pillow 48763.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:14.926 havoc S incinerate Fluffy_Pillow 49678.0/50000: 99% mana
1.0/5: 20% soul_shard
1:16.666 havoc S incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:18.406 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
1:19.713 aoe E channel_demonfire Fluffy_Pillow 49025.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:22.597 aoe F immolate Fluffy_Pillow 49717.5/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:23.906 aoe F immolate enemy3 49253.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
1:25.212 aoe F immolate enemy2 49156.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
1:26.518 aoe I rain_of_fire Fluffy_Pillow 49059.5/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
1:27.824 aoe L incinerate Fluffy_Pillow 49712.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
1:29.044 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
1:30.352 aoe K scouring_tithe Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:32.093 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:33.313 aoe L incinerate Fluffy_Pillow 48612.5/50000: 97% mana
2.9/5: 58% soul_shard
1:35.054 default A cataclysm Fluffy_Pillow 48483.0/50000: 97% mana
3.4/5: 68% soul_shard
1:36.796 aoe I rain_of_fire Fluffy_Pillow 48854.0/50000: 98% mana
3.6/5: 72% soul_shard
1:38.102 default 9 soul_fire Fluffy_Pillow 49507.0/50000: 99% mana
0.8/5: 16% soul_shard
1:41.580 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
1:44.470 aoe H havoc enemy2 49697.5/50000: 99% mana
2.6/5: 52% soul_shard
1:45.778 havoc N conflagrate Fluffy_Pillow 49351.5/50000: 99% mana
2.8/5: 56% soul_shard
1:47.087 havoc R chaos_bolt Fluffy_Pillow 49506.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
1:48.916 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:50.222 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:51.964 havoc R chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:53.791 havoc N conflagrate Fluffy_Pillow 49916.5/50000: 100% mana
1.9/5: 38% soul_shard
1:55.098 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
1:56.405 aoe F immolate enemy3 49252.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:57.712 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:59.018 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
2:00.237 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
2:01.977 aoe J conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
2:03.283 aoe E channel_demonfire Fluffy_Pillow 49025.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:06.337 aoe L incinerate Fluffy_Pillow 49802.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
2:07.558 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
3.1/5: 62% soul_shard
2:09.298 aoe I rain_of_fire Fluffy_Pillow 49373.0/50000: 99% mana
3.3/5: 66% soul_shard
2:10.602 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:11.909 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:13.650 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:14.868 aoe H havoc enemy2 48611.5/50000: 97% mana
2.0/5: 40% soul_shard
2:16.175 havoc R chaos_bolt Fluffy_Pillow 48265.0/50000: 97% mana
2.1/5: 42% soul_shard
2:18.784 havoc S incinerate Fluffy_Pillow 49569.5/50000: 99% mana
0.6/5: 12% soul_shard
2:20.524 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:21.829 havoc Q immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:23.138 havoc R chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:24.966 havoc S incinerate Fluffy_Pillow 49973.0/50000: 100% mana
0.6/5: 12% soul_shard
2:26.707 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
2:30.187 aoe E channel_demonfire Fluffy_Pillow 49003.5/50000: 98% mana
2.8/5: 56% soul_shard
2:32.990 aoe F immolate enemy3 49655.0/50000: 99% mana
3.3/5: 66% soul_shard
2:34.296 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
2:35.603 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.5/5: 10% soul_shard
2:36.909 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
2:38.650 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:39.868 default A cataclysm Fluffy_Pillow 48611.5/50000: 97% mana
1.8/5: 36% soul_shard
2:41.609 aoe J conflagrate Fluffy_Pillow 48982.0/50000: 98% mana
1.9/5: 38% soul_shard
2:42.914 aoe L incinerate Fluffy_Pillow 49134.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:44.136 aoe J conflagrate Fluffy_Pillow 48745.5/50000: 97% mana
2.8/5: 56% soul_shard
2:45.599 aoe H havoc enemy2 48977.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
2:46.907 havoc R chaos_bolt Fluffy_Pillow 48631.0/50000: 97% mana
3.7/5: 74% soul_shard
backdraft
2:48.734 havoc S incinerate Fluffy_Pillow 49544.5/50000: 99% mana
1.9/5: 38% soul_shard
2:50.474 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
2:53.082 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
2:54.390 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
2:55.697 havoc R chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
2:57.525 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:59.266 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
3:02.069 aoe F immolate enemy3 49654.0/50000: 99% mana
1.4/5: 28% soul_shard
3:03.375 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.5/5: 30% soul_shard
3:04.682 aoe F immolate Fluffy_Pillow 49405.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:05.988 aoe F immolate enemy2 49252.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
3:07.295 cds M summon_infernal Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:08.603 aoe L incinerate Fluffy_Pillow 48809.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:09.825 aoe D rain_of_fire Fluffy_Pillow 48420.5/50000: 97% mana
3.5/5: 70% soul_shard
3:11.132 aoe J conflagrate Fluffy_Pillow 49074.0/50000: 98% mana
0.8/5: 16% soul_shard
3:12.438 default A cataclysm Fluffy_Pillow 49227.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:14.178 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
3:15.398 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
3:18.877 aoe H havoc enemy2 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
3:20.183 havoc P scouring_tithe Fluffy_Pillow 48656.0/50000: 97% mana
5.0/5: 100% soul_shard
3:21.925 havoc R chaos_bolt Fluffy_Pillow 48527.0/50000: 97% mana
5.0/5: 100% soul_shard
3:24.535 havoc N conflagrate Fluffy_Pillow 49832.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.842 havoc R chaos_bolt Fluffy_Pillow 49985.5/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:27.668 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.974 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
3:30.802 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:32.108 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.2/5: 64% soul_shard
3:33.414 aoe E channel_demonfire Fluffy_Pillow 49905.0/50000: 100% mana
0.7/5: 14% soul_shard
3:36.219 aoe F immolate enemy2 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
3:37.524 aoe F immolate enemy3 49251.5/50000: 99% mana
2.0/5: 40% soul_shard
3:38.831 aoe J conflagrate Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
3:40.137 aoe K scouring_tithe Fluffy_Pillow 49308.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:41.878 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:43.098 aoe I rain_of_fire Fluffy_Pillow 48612.5/50000: 97% mana
3.3/5: 66% soul_shard
3:44.404 default A cataclysm Fluffy_Pillow 49265.5/50000: 99% mana
0.4/5: 8% soul_shard
3:46.145 aoe J conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
0.6/5: 12% soul_shard
3:47.451 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:48.669 aoe H havoc enemy2 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
3:50.183 havoc S incinerate Fluffy_Pillow 48758.5/50000: 98% mana
1.7/5: 34% soul_shard
3:51.924 havoc R chaos_bolt Fluffy_Pillow 48629.0/50000: 97% mana
2.5/5: 50% soul_shard
3:54.535 havoc S incinerate Fluffy_Pillow 49934.5/50000: 100% mana
0.8/5: 16% soul_shard
3:56.275 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
3:57.581 havoc Q immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
3:58.887 havoc R chaos_bolt Fluffy_Pillow 49058.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
4:00.715 havoc P scouring_tithe Fluffy_Pillow 49972.0/50000: 100% mana
0.8/5: 16% soul_shard
4:02.455 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
4:05.271 default 9 soul_fire Fluffy_Pillow 49660.0/50000: 99% mana
1.4/5: 28% soul_shard
4:08.748 aoe F immolate enemy3 49002.0/50000: 98% mana
2.8/5: 56% soul_shard
4:10.054 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
3.1/5: 62% soul_shard
4:11.361 aoe I rain_of_fire Fluffy_Pillow 48808.5/50000: 98% mana
3.2/5: 64% soul_shard
4:12.667 aoe J conflagrate Fluffy_Pillow 49461.5/50000: 99% mana
0.5/5: 10% soul_shard
4:13.972 aoe L incinerate Fluffy_Pillow 49614.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
4:15.191 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:16.497 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:18.236 aoe L incinerate Fluffy_Pillow 49501.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
4:19.457 aoe H havoc enemy2 49003.0/50000: 98% mana
2.9/5: 58% soul_shard
4:20.763 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
3.1/5: 62% soul_shard
4:22.069 havoc P scouring_tithe Fluffy_Pillow 48809.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
4:23.809 havoc R chaos_bolt Fluffy_Pillow 48679.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
4:25.636 havoc R chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.6/5: 52% soul_shard
4:28.244 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:29.550 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
4:30.857 aoe E channel_demonfire Fluffy_Pillow 49405.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
4:33.704 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
4:34.923 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
4:36.662 aoe F immolate enemy3 48871.5/50000: 98% mana
3.5/5: 70% soul_shard
4:37.969 aoe I rain_of_fire Fluffy_Pillow 48775.0/50000: 98% mana
3.6/5: 72% soul_shard
4:39.274 aoe F immolate enemy2 49427.5/50000: 99% mana
0.8/5: 16% soul_shard
4:40.580 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
4:41.885 aoe K scouring_tithe Fluffy_Pillow 49404.5/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
4:43.626 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:44.932 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:46.151 aoe J conflagrate Fluffy_Pillow 48515.0/50000: 97% mana
2.2/5: 44% soul_shard
4:47.457 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
4:48.675 default A cataclysm Fluffy_Pillow 48277.0/50000: 97% mana
3.2/5: 64% soul_shard
4:50.416 aoe H havoc enemy2 48647.5/50000: 97% mana
3.5/5: 70% soul_shard
4:51.722 havoc R chaos_bolt Fluffy_Pillow 48300.5/50000: 97% mana
3.5/5: 70% soul_shard
4:54.331 havoc N conflagrate Fluffy_Pillow 49605.0/50000: 99% mana
1.9/5: 38% soul_shard
4:55.635 havoc O soul_fire Fluffy_Pillow 49757.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
4:59.113 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.939 aoe E channel_demonfire Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
5:03.776 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
5:05.084 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
5:06.391 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
5:08.133 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
5:09.352 aoe F immolate enemy3 48612.5/50000: 97% mana
1.7/5: 34% soul_shard
5:10.658 aoe L incinerate Fluffy_Pillow 48515.5/50000: 97% mana
1.9/5: 38% soul_shard
5:12.398 aoe J conflagrate Fluffy_Pillow 48385.5/50000: 97% mana
2.2/5: 44% soul_shard
5:13.707 aoe L incinerate Fluffy_Pillow 48540.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
5:14.927 aoe F immolate Fluffy_Pillow 48150.0/50000: 96% mana
3.2/5: 64% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_DuplicitousHavoc"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=208:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_InfernalBrand : 9261 dps, 5032 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9261.4 9261.4 15.3 / 0.165% 737.7 / 8.0% 19.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
407.6 404.7 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_InfernalBrand 9261
Cataclysm 772 8.4% 9.6 32.35sec 23883 14058 Direct 28.9 6699 13393 7961 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 28.85 0.00 0.00 1.6989 0.0000 229712.75 229712.75 0.00% 14058.31 14058.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.15% 23.41 15 33 6698.80 6142 7261 6698.66 6505 6913 156856 156856 0.00%
crit 18.85% 5.44 0 14 13392.68 12283 14521 13336.25 0 14486 72857 72857 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.68
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (998) 0.0% (10.8%) 11.9 26.26sec 25004 9243

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.86 0.00 176.91 0.00 2.7051 0.1643 0.00 0.00 0.00% 9243.41 9243.41

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.86
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 998 10.8% 0.0 0.00sec 0 0 Direct 530.7 469 936 559 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 530.73 0.00 0.00 0.0000 0.0000 296611.86 296611.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 428.58 312 560 468.97 263 976 468.99 447 500 200979 200979 0.00%
crit 19.25% 102.15 67 153 936.10 525 1952 936.56 797 1082 95633 95633 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1070 (1442) 11.6% (15.6%) 18.7 15.39sec 22857 11493 Direct 37.3 (73.6) 0 8523 8523 100.0% (60.2%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.75 37.29 0.00 0.00 1.9888 0.0000 317834.03 317834.03 0.00% 11493.28 11493.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 37.29 26 52 8523.03 5861 11547 8523.39 8314 8728 317834 317834 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.85
  • if_expr:cast_time<havoc_remains
    Internal Combustion 372 4.0% 36.3 15.45sec 3048 0 Direct 36.3 2557 5096 3052 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.30 36.29 0.00 0.00 0.0000 0.0000 110647.02 110647.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 29.27 17 43 2557.41 1 3715 2560.57 2274 2840 74857 74857 0.00%
crit 19.36% 7.03 1 18 5095.78 2 7430 5082.15 1155 7414 35790 35790 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 792 8.6% 36.6 7.95sec 6439 5156 Direct 54.4 3622 7254 4326 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.55 54.43 0.00 0.00 1.2490 0.0000 235370.95 235370.95 0.00% 5155.54 5155.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 43.90 31 60 3621.69 2047 5042 3622.41 3394 3920 158980 158980 0.00%
crit 19.35% 10.53 2 24 7254.15 4095 10083 7253.57 5603 8885 76391 76391 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.68
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.88
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1590 17.2% 25.2 11.20sec 18750 14894 Direct 31.5 1515 3038 1801 18.8%
Periodic 344.1 1015 2029 1210 19.3% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.23 31.48 344.08 344.08 1.2589 2.4821 473095.10 473095.10 0.00% 534.09 14894.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 25.56 16 36 1514.67 819 2017 1515.48 1407 1644 38727 38727 0.00%
crit 18.81% 5.92 0 14 3038.28 1639 4033 3019.28 0 3807 17988 17988 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 277.75 215 354 1014.55 0 1261 1014.62 992 1039 281795 281795 0.00%
crit 19.28% 66.33 41 96 2028.90 1 2521 2029.15 1942 2110 134586 134586 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.53
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.82
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 521 5.6% 39.0 7.11sec 3982 2829 Direct 49.6 (49.6) 2626 5228 3130 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.99 49.59 0.00 0.00 1.4076 0.0000 155258.44 155258.44 0.00% 2829.36 2829.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 39.97 25 59 2625.65 1312 3232 2627.40 2457 2847 104936 104936 0.00%
crit 19.41% 9.63 2 21 5227.88 2624 6464 5237.77 4225 6285 50323 50323 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.26
    havoc
    [S]:10.94
  • if_expr:cast_time<havoc_remains
Rain of Fire 962 10.4% 18.3 15.66sec 15629 12596 Periodic 433.8 553 1106 659 19.1% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.28 0.00 0.00 433.80 1.2408 0.0000 285653.12 285653.12 0.00% 12596.05 12596.05
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.87% 350.81 250 476 552.72 507 599 552.68 543 560 193888 193888 0.00%
crit 19.13% 83.00 50 122 1105.69 1013 1198 1105.72 1081 1123 91765 91765 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.45
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.82
Scouring Tithe 329 3.6% 13.3 22.68sec 7364 4383 Direct 18.6 1485 2953 1765 19.0%
Periodic 132.2 413 827 493 19.2% 36.4%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.30 18.61 132.17 132.17 1.6803 2.4555 97930.22 97930.22 0.00% 282.32 4382.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.02% 15.07 8 23 1484.64 1004 1674 1485.08 1365 1623 22374 22374 0.00%
crit 18.98% 3.53 0 11 2953.19 2009 3348 2888.52 0 3348 10440 10440 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 106.73 76 141 413.08 123 419 413.07 410 416 44087 44087 0.00%
crit 19.25% 25.44 8 46 826.58 246 837 826.58 786 837 21029 21029 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.65
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.71
Soul Fire 478 5.2% 5.5 49.51sec 25716 7395 Direct 7.3 16257 32648 19457 19.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.32 0.00 0.00 3.4775 0.0000 142354.66 142354.66 0.00% 7395.43 7395.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 5.89 1 10 16257.40 8601 21175 16291.77 12848 19451 95722 95722 0.00%
crit 19.53% 1.43 0 6 32647.98 17214 42348 24991.49 0 42170 46632 46632 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.76
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.87
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.54sec 12011 10386 Direct 6.0 3348 6696 4002 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24022.06 24022.06 0.00% 10385.67 10385.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 4.83 1 6 3348.13 3348 3348 3348.13 3348 3348 16156 16156 0.00%
crit 19.58% 1.17 0 5 6696.27 6696 6696 4962.61 0 6696 7866 7866 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3828 / 782
Immolation 3562 7.8% 39.0 5.49sec 5481 0 Direct 117.0 1529 3056 1827 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213741.62 213741.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 94.21 80 106 1529.45 1395 2023 1529.49 1497 1562 144090 144090 0.00%
crit 19.48% 22.79 11 37 3056.30 2790 4046 3057.27 2826 3311 69651 69651 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15964.17 22803.23 29.99% 271.02 271.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.40% 32.96 25 40 325.55 326 326 325.55 326 326 10731 15328 29.99%
crit 19.60% 8.04 1 16 651.10 651 651 651.10 651 651 5233 7475 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 513 / 513
Firebolt 513 5.5% 92.6 3.21sec 1648 1132 Direct 91.9 1395 2790 1661 19.0%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152575.81 152575.81 0.00% 1131.94 1131.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 74.38 55 96 1395.06 1395 1395 1395.06 1395 1395 103762 103762 0.00%
crit 19.04% 17.50 7 33 2790.11 2790 2790 2790.11 2790 2790 48813 48813 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Kyrian_InfernalBrand
Havoc 9.6 32.18sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.56 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.57
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.5sec 54.71% 0.00% 0.0 (0.0) 3.1

Buff Details

  • buff initial source:Kyrian_InfernalBrand
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.71%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_InfernalBrand
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_InfernalBrand_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_InfernalBrand_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 186.4s
  • trigger_min/max:180.0s / 186.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.96% 7.82% 13.74% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_InfernalBrand
soul_fire Soul Shard 6.55 6.91 7.37% 1.06 0.49 6.64%
immolate Soul Shard 344.15 33.13 35.35% 0.10 1.28 3.73%
incinerate Soul Shard 39.01 9.95 10.62% 0.26 0.03 0.30%
conflagrate Soul Shard 36.55 27.21 29.04% 0.74 0.00 0.00%
mana_regen Mana 654.81 120459.99 100.00% 183.96 28070.56 18.90%
immolate_crits Soul Shard 33.37 3.21 3.43% 0.10 0.13 3.78%
incinerate_crits Soul Shard 9.61 0.96 1.02% 0.10 0.00 0.16%
infernal Soul Shard 120.00 10.29 10.98% 0.09 1.71 14.25%
souring_tithe Soul Shard 1.00 2.05 2.19% 2.05 2.96 59.06%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 404.68 407.60 28081.3 49131.1 47649.0 50000.0
Soul Shard 4.0 0.32 0.31 6.6 4.4 0.2 5.0
Usage Type Count Total Avg RPE APR
Kyrian_InfernalBrand
cataclysm Mana 9.6 4813.9 500.0 500.5 47.7
channel_demonfire Mana 11.9 8893.5 750.0 749.7 33.4
chaos_bolt Soul Shard 18.7 37.5 2.0 2.0 11434.3
conflagrate Mana 36.6 18276.0 500.0 500.0 12.9
havoc Mana 9.6 9571.0 1000.0 1000.7 0.0
immolate Mana 25.2 18922.7 750.0 750.0 25.0
incinerate Mana 39.0 39009.5 1000.0 1000.6 4.0
rain_of_fire Soul Shard 18.3 54.8 3.0 3.0 5211.3
scouring_tithe Mana 13.3 13299.7 1000.0 1000.1 7.4
soul_fire Mana 6.5 6547.3 1000.0 1182.8 21.7
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Kyrian_InfernalBrand Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Kyrian_InfernalBrand Damage Per Second
Count 618
Mean 9261.44
Minimum 8774.64
Maximum 9862.65
Spread ( max - min ) 1088.01
Range [ ( max - min ) / 2 * 100% ] 5.87%
Standard Deviation 193.6168
5th Percentile 8958.41
95th Percentile 9607.24
( 95th Percentile - 5th Percentile ) 648.83
Mean Distribution
Standard Deviation 7.7884
95.00% Confidence Interval ( 9246.18 - 9276.71 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1679
0.1 Scale Factor Error with Delta=300 321
0.05 Scale Factor Error with Delta=300 1281
0.01 Scale Factor Error with Delta=300 32002
Priority Target DPS
Kyrian_InfernalBrand Priority Target Damage Per Second
Count 618
Mean 5032.20
Minimum 4682.63
Maximum 5404.71
Spread ( max - min ) 722.09
Range [ ( max - min ) / 2 * 100% ] 7.17%
Standard Deviation 118.7322
5th Percentile 4848.84
95th Percentile 5242.01
( 95th Percentile - 5th Percentile ) 393.17
Mean Distribution
Standard Deviation 4.7761
95.00% Confidence Interval ( 5022.84 - 5041.56 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2139
0.1 Scale Factor Error with Delta=300 121
0.05 Scale Factor Error with Delta=300 482
0.01 Scale Factor Error with Delta=300 12035
DPS(e)
Kyrian_InfernalBrand Damage Per Second (Effective)
Count 618
Mean 9261.44
Minimum 8774.64
Maximum 9862.65
Spread ( max - min ) 1088.01
Range [ ( max - min ) / 2 * 100% ] 5.87%
Damage
Kyrian_InfernalBrand Damage
Count 618
Mean 2368490.20
Minimum 1899889.28
Maximum 2903367.59
Spread ( max - min ) 1003478.31
Range [ ( max - min ) / 2 * 100% ] 21.18%
DTPS
Kyrian_InfernalBrand Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_InfernalBrand Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_InfernalBrand Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_InfernalBrand Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_InfernalBrand Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_InfernalBrand Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_InfernalBrandTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_InfernalBrand Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.76 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.68 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.45 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.86 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.53 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.57 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.82 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.68 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.65 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.26 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.88 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.87 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.71 scouring_tithe
Q 7.82 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.85 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 10.94 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFELDFFJKDLJLJADLEHNRSRONFFIKELJLIAJLHNRSPQREJFLJLLFI9AHNPRNRSQEFJLFILJKLLIAHSNRSNQS9EIFJKILJLLAHNRSRSNPFEFFIMJLLD9AHNPRNRRNEDFFFLJKLIJLAHSRSNQRP9EFIJFLJLLAHNPRNRRQEFJFLLFJIKL9AEHNRNRQPLIJL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.016 cds M summon_infernal Fluffy_Pillow 49758.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.023 aoe H havoc enemy2 49261.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.029 havoc P scouring_tithe Fluffy_Pillow 48764.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:07.370 havoc R chaos_bolt Fluffy_Pillow 48435.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.380 havoc N conflagrate Fluffy_Pillow 49440.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.388 havoc R chaos_bolt Fluffy_Pillow 49444.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:11.796 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:12.801 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.807 havoc R chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:15.214 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.219 aoe D rain_of_fire Fluffy_Pillow 49958.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.225 aoe F immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:18.232 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:20.741 aoe L incinerate Fluffy_Pillow 49757.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:21.681 aoe D rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust
0:22.686 aoe F immolate enemy2 49505.0/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust
0:23.692 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust
0:24.698 aoe J conflagrate Fluffy_Pillow 49005.0/50000: 98% mana
1.7/5: 34% soul_shard
bloodlust
0:25.704 aoe K scouring_tithe Fluffy_Pillow 49008.0/50000: 98% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:27.045 aoe D rain_of_fire Fluffy_Pillow 48678.5/50000: 97% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:28.053 aoe L incinerate Fluffy_Pillow 49182.5/50000: 98% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:28.991 aoe J conflagrate Fluffy_Pillow 48651.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:29.997 aoe L incinerate Fluffy_Pillow 48654.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:30.936 aoe J conflagrate Fluffy_Pillow 48124.0/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust
0:31.943 default A cataclysm Fluffy_Pillow 48127.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:33.284 aoe D rain_of_fire Fluffy_Pillow 48298.0/50000: 97% mana
3.6/5: 72% soul_shard
bloodlust, backdraft
0:34.290 aoe L incinerate Fluffy_Pillow 48801.0/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust, backdraft
0:35.229 aoe E channel_demonfire Fluffy_Pillow 48270.5/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:37.391 aoe H havoc enemy2 48601.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust
0:38.397 havoc N conflagrate Fluffy_Pillow 48104.5/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:39.403 havoc R chaos_bolt Fluffy_Pillow 48107.5/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:40.808 havoc S incinerate Fluffy_Pillow 48810.0/50000: 98% mana
1.4/5: 28% soul_shard
bloodlust
0:42.149 havoc R chaos_bolt Fluffy_Pillow 48480.5/50000: 97% mana
2.2/5: 44% soul_shard
0:44.759 havoc O soul_fire Fluffy_Pillow 49785.5/50000: 100% mana
0.7/5: 14% soul_shard
0:48.478 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
0:49.784 aoe F immolate Fluffy_Pillow 49155.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
0:51.092 aoe F immolate enemy3 49059.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
0:52.398 aoe I rain_of_fire Fluffy_Pillow 48962.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
0:53.706 aoe K scouring_tithe Fluffy_Pillow 49616.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
0:55.445 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
0:58.294 aoe L incinerate Fluffy_Pillow 49676.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
0:59.514 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
1:00.820 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:02.040 aoe I rain_of_fire Fluffy_Pillow 48765.5/50000: 98% mana
3.0/5: 60% soul_shard
1:03.348 default A cataclysm Fluffy_Pillow 49419.5/50000: 99% mana
0.4/5: 8% soul_shard
1:05.087 aoe J conflagrate Fluffy_Pillow 49501.5/50000: 99% mana
0.4/5: 8% soul_shard
1:06.394 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
1:07.614 aoe H havoc enemy2 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:08.922 havoc N conflagrate Fluffy_Pillow 48656.5/50000: 97% mana
1.7/5: 34% soul_shard
1:10.391 havoc R chaos_bolt Fluffy_Pillow 48891.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:12.217 havoc S incinerate Fluffy_Pillow 49804.0/50000: 100% mana
1.0/5: 20% soul_shard
1:13.956 havoc P scouring_tithe Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
1:15.695 havoc Q immolate Fluffy_Pillow 48871.0/50000: 98% mana
1.8/5: 36% soul_shard
1:17.002 havoc R chaos_bolt Fluffy_Pillow 48774.5/50000: 98% mana
2.0/5: 40% soul_shard
1:19.612 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
1:22.508 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:23.816 aoe F immolate enemy3 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
1:25.122 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
1:26.342 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.7/5: 34% soul_shard
1:27.690 aoe L incinerate Fluffy_Pillow 49036.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:28.910 aoe L incinerate Fluffy_Pillow 48646.0/50000: 97% mana
2.7/5: 54% soul_shard
1:30.652 aoe F immolate enemy2 48517.0/50000: 97% mana
3.1/5: 62% soul_shard
1:31.959 aoe I rain_of_fire Fluffy_Pillow 48420.5/50000: 97% mana
3.4/5: 68% soul_shard
1:33.268 default 9 soul_fire Fluffy_Pillow 49075.0/50000: 98% mana
0.4/5: 8% soul_shard
1:36.951 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
1:38.691 aoe H havoc enemy2 49372.5/50000: 99% mana
2.0/5: 40% soul_shard
1:39.995 havoc N conflagrate Fluffy_Pillow 49024.5/50000: 98% mana
2.2/5: 44% soul_shard
1:41.304 havoc P scouring_tithe Fluffy_Pillow 49179.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:43.043 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:44.872 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
1.8/5: 36% soul_shard
1:46.178 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:48.006 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:49.746 havoc Q immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
1:51.052 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
1.9/5: 38% soul_shard
1:53.941 aoe F immolate enemy2 49599.5/50000: 99% mana
2.2/5: 44% soul_shard
1:55.247 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.4/5: 48% soul_shard
1:56.554 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
1:57.772 aoe F immolate enemy3 49001.5/50000: 98% mana
3.3/5: 66% soul_shard
1:59.078 aoe I rain_of_fire Fluffy_Pillow 48904.5/50000: 98% mana
3.5/5: 70% soul_shard
2:00.384 aoe L incinerate Fluffy_Pillow 49557.5/50000: 99% mana
0.7/5: 14% soul_shard
2:02.125 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:03.430 aoe K scouring_tithe Fluffy_Pillow 49155.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
2:05.171 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
2:06.390 aoe L incinerate Fluffy_Pillow 48612.0/50000: 97% mana
2.5/5: 50% soul_shard
2:08.130 aoe I rain_of_fire Fluffy_Pillow 48482.0/50000: 97% mana
3.0/5: 60% soul_shard
2:09.438 default A cataclysm Fluffy_Pillow 49136.0/50000: 98% mana
0.1/5: 2% soul_shard
2:11.179 aoe H havoc enemy2 49502.5/50000: 99% mana
0.6/5: 12% soul_shard
2:12.485 havoc S incinerate Fluffy_Pillow 49155.5/50000: 98% mana
0.6/5: 12% soul_shard
2:14.226 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:15.532 havoc R chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:17.361 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:19.102 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:20.408 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:21.714 havoc S incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:22.933 default 9 soul_fire Fluffy_Pillow 48668.0/50000: 97% mana
3.1/5: 62% soul_shard
2:26.409 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
4.5/5: 90% soul_shard
2:29.223 aoe I rain_of_fire Fluffy_Pillow 49658.5/50000: 99% mana
4.9/5: 98% soul_shard
2:30.529 aoe F immolate enemy3 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
2:31.834 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.3/5: 46% soul_shard
2:33.140 aoe K scouring_tithe Fluffy_Pillow 49404.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:34.881 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:36.187 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft
2:37.406 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
2:38.714 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:39.934 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
1.7/5: 34% soul_shard
2:41.676 default A cataclysm Fluffy_Pillow 48637.0/50000: 97% mana
2.0/5: 40% soul_shard
2:43.416 aoe H havoc enemy2 49007.0/50000: 98% mana
2.2/5: 44% soul_shard
2:44.723 havoc N conflagrate Fluffy_Pillow 48660.5/50000: 97% mana
2.3/5: 46% soul_shard
2:46.029 havoc R chaos_bolt Fluffy_Pillow 48813.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
2:47.856 havoc S incinerate Fluffy_Pillow 49727.0/50000: 99% mana
1.8/5: 36% soul_shard
2:49.597 havoc R chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
2:52.207 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:53.947 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:55.252 havoc P scouring_tithe Fluffy_Pillow 49154.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:56.993 aoe F immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:58.299 aoe E channel_demonfire Fluffy_Pillow 48905.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
3:01.134 aoe F immolate enemy2 49573.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
3:02.440 aoe F immolate enemy3 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
3:03.746 aoe I rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:05.054 cds M summon_infernal Fluffy_Pillow 49809.0/50000: 100% mana
0.3/5: 6% soul_shard
3:06.361 aoe J conflagrate Fluffy_Pillow 49462.5/50000: 99% mana
0.7/5: 14% soul_shard
3:07.668 aoe L incinerate Fluffy_Pillow 49616.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:08.887 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
3:10.628 aoe D rain_of_fire Fluffy_Pillow 48872.5/50000: 98% mana
3.1/5: 62% soul_shard
3:11.935 default 9 soul_fire Fluffy_Pillow 49526.0/50000: 99% mana
0.5/5: 10% soul_shard
3:15.413 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
3:17.153 aoe H havoc enemy2 49372.5/50000: 99% mana
3.3/5: 66% soul_shard
3:18.460 havoc N conflagrate Fluffy_Pillow 49026.0/50000: 98% mana
3.7/5: 74% soul_shard
3:19.766 havoc P scouring_tithe Fluffy_Pillow 49179.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:21.505 havoc R chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:23.334 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
3:24.641 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:26.467 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:29.075 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
3:30.381 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
3:33.227 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
3:34.533 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
3:35.841 aoe F immolate enemy3 49253.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
3:37.148 aoe F immolate enemy2 49156.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:38.456 aoe L incinerate Fluffy_Pillow 49060.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
3:39.676 aoe J conflagrate Fluffy_Pillow 48670.5/50000: 97% mana
1.8/5: 36% soul_shard
3:40.982 aoe K scouring_tithe Fluffy_Pillow 48823.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
3:42.724 aoe L incinerate Fluffy_Pillow 48694.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
3:43.943 aoe I rain_of_fire Fluffy_Pillow 48304.0/50000: 97% mana
3.1/5: 62% soul_shard
3:45.248 aoe J conflagrate Fluffy_Pillow 48956.5/50000: 98% mana
0.2/5: 4% soul_shard
3:46.554 aoe L incinerate Fluffy_Pillow 49109.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:47.775 default A cataclysm Fluffy_Pillow 48720.0/50000: 97% mana
1.5/5: 30% soul_shard
3:49.517 aoe H havoc enemy2 49091.0/50000: 98% mana
1.8/5: 36% soul_shard
3:50.823 havoc S incinerate Fluffy_Pillow 48744.0/50000: 97% mana
1.8/5: 36% soul_shard
3:52.564 havoc R chaos_bolt Fluffy_Pillow 48614.5/50000: 97% mana
2.5/5: 50% soul_shard
3:55.173 havoc S incinerate Fluffy_Pillow 49919.0/50000: 100% mana
0.9/5: 18% soul_shard
3:56.914 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
3:58.220 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:59.527 havoc R chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:01.356 havoc P scouring_tithe Fluffy_Pillow 49973.5/50000: 100% mana
1.1/5: 22% soul_shard
4:03.097 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:06.574 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
4:09.405 aoe F immolate enemy3 49667.5/50000: 99% mana
3.0/5: 60% soul_shard
4:10.711 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
4:12.016 aoe J conflagrate Fluffy_Pillow 49904.5/50000: 100% mana
0.3/5: 6% soul_shard
4:13.322 aoe F immolate enemy2 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
4:14.627 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
4:15.848 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.6/5: 32% soul_shard
4:17.156 aoe L incinerate Fluffy_Pillow 49016.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:18.376 aoe L incinerate Fluffy_Pillow 48626.0/50000: 97% mana
2.7/5: 54% soul_shard
4:20.116 default A cataclysm Fluffy_Pillow 48496.0/50000: 97% mana
3.0/5: 60% soul_shard
4:21.856 aoe H havoc enemy2 48866.0/50000: 98% mana
3.3/5: 66% soul_shard
4:23.165 havoc N conflagrate Fluffy_Pillow 48520.5/50000: 97% mana
3.6/5: 72% soul_shard
4:24.472 havoc P scouring_tithe Fluffy_Pillow 48674.0/50000: 97% mana
4.7/5: 94% soul_shard
backdraft
4:26.213 havoc R chaos_bolt Fluffy_Pillow 48544.5/50000: 97% mana
5.0/5: 100% soul_shard
backdraft
4:28.040 havoc N conflagrate Fluffy_Pillow 49458.0/50000: 99% mana
3.0/5: 60% soul_shard
4:29.347 havoc R chaos_bolt Fluffy_Pillow 49611.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:31.174 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
4:33.783 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:35.089 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
4:37.976 aoe F immolate enemy2 49945.5/50000: 100% mana
1.0/5: 20% soul_shard
4:39.284 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
4:40.591 aoe F immolate enemy3 49406.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
4:41.897 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
4:43.118 aoe L incinerate Fluffy_Pillow 48862.5/50000: 98% mana
2.2/5: 44% soul_shard
4:44.857 aoe F immolate Fluffy_Pillow 48732.0/50000: 97% mana
2.8/5: 56% soul_shard
4:46.163 aoe J conflagrate Fluffy_Pillow 48635.0/50000: 97% mana
2.8/5: 56% soul_shard
4:47.470 aoe I rain_of_fire Fluffy_Pillow 48788.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:48.777 aoe K scouring_tithe Fluffy_Pillow 49442.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
4:50.515 aoe L incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
4:51.735 default 9 soul_fire Fluffy_Pillow 48611.0/50000: 97% mana
1.4/5: 28% soul_shard
4:55.211 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
3.0/5: 60% soul_shard
4:56.952 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
3.1/5: 62% soul_shard
4:59.822 aoe H havoc enemy2 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
5:01.129 havoc N conflagrate Fluffy_Pillow 49653.5/50000: 99% mana
3.6/5: 72% soul_shard
5:02.436 havoc R chaos_bolt Fluffy_Pillow 49807.0/50000: 100% mana
4.9/5: 98% soul_shard
backdraft
5:04.265 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:05.572 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
5:07.402 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:08.709 havoc P scouring_tithe Fluffy_Pillow 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
5:10.448 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
2.8/5: 56% soul_shard
5:12.188 aoe I rain_of_fire Fluffy_Pillow 48871.5/50000: 98% mana
3.1/5: 62% soul_shard
5:13.493 aoe J conflagrate Fluffy_Pillow 49524.0/50000: 99% mana
0.4/5: 8% soul_shard
5:14.800 aoe L incinerate Fluffy_Pillow 49677.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_InfernalBrand"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=214:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Kyrian_SoulTithe : 9205 dps, 4969 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9205.1 9205.1 16.1 / 0.174% 766.1 / 8.3% 19.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
408.1 405.3 Mana 0.00% 38.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_SoulTithe 9205
Cataclysm 780 8.5% 9.6 32.29sec 24055 14159 Direct 28.9 6704 13390 8020 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.64 28.91 0.00 0.00 1.6990 0.0000 231833.64 231833.64 0.00% 14158.64 14158.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 23.23 14 32 6704.16 6141 7261 6703.63 6504 6919 155742 155742 0.00%
crit 19.65% 5.68 0 12 13389.72 12284 14521 13333.14 0 14372 76092 76092 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (995) 0.0% (10.8%) 11.8 26.10sec 25045 9257

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.81 0.00 176.31 0.00 2.7057 0.1643 0.00 0.00 0.00% 9256.55 9256.55

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.82
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 995 10.8% 0.0 0.00sec 0 0 Direct 528.9 469 938 559 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 528.92 0.00 0.00 0.0000 0.0000 295876.22 295876.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 427.21 306 564 469.30 263 976 469.54 437 499 200503 200503 0.00%
crit 19.23% 101.71 65 149 937.72 525 1952 937.93 806 1077 95373 95373 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1061 (1429) 11.5% (15.5%) 18.6 15.52sec 22846 11500 Direct 37.0 (72.9) 0 8530 8530 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.59 36.96 0.00 0.00 1.9867 0.0000 315314.89 315314.89 0.00% 11499.61 11499.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 36.96 26 50 8530.38 5861 11548 8530.46 8283 8737 315315 315315 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [R]:18.69
  • if_expr:cast_time<havoc_remains
    Internal Combustion 368 4.0% 36.0 15.54sec 3038 0 Direct 36.0 2556 5104 3039 18.9%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.98 35.98 0.00 0.00 0.0000 0.0000 109331.31 109331.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 29.17 14 42 2556.18 1 3715 2559.06 2244 2880 74554 74554 0.00%
crit 18.94% 6.81 1 15 5104.06 2 7430 5101.69 2937 7156 34777 34777 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 792 8.6% 36.5 7.96sec 6438 5154 Direct 54.4 3624 7220 4321 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.55 54.45 0.00 0.00 1.2490 0.0000 235265.86 235265.86 0.00% 5154.14 5154.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 43.88 29 59 3623.69 2047 5042 3624.08 3403 3890 158989 158989 0.00%
crit 19.41% 10.57 1 23 7220.40 4094 10084 7216.32 5431 8944 76277 76277 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.66
  • if_expr:buff.backdraft.down
    havoc
    [N]:17.88
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1591 17.3% 25.2 11.36sec 18792 14928 Direct 31.3 1517 3027 1813 19.6%
Periodic 344.1 1015 2028 1210 19.3% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.18 31.34 344.05 344.05 1.2588 2.4819 473113.40 473113.40 0.00% 534.22 14928.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.40% 25.20 15 36 1517.32 819 2017 1518.16 1402 1630 38249 38249 0.00%
crit 19.60% 6.14 1 14 3027.46 1643 4033 3021.66 1947 4012 18585 18585 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 277.73 209 350 1014.57 0 1261 1014.79 989 1040 281803 281803 0.00%
crit 19.28% 66.33 40 97 2027.70 2 2521 2027.42 1923 2126 134476 134476 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:17.54
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [Q]:7.74
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 522 5.7% 39.2 7.12sec 3966 2815 Direct 49.9 (49.9) 2621 5237 3112 18.8% (18.8%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.19 49.93 0.00 0.00 1.4089 0.0000 155437.01 155437.01 0.00% 2815.33 2815.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 40.54 25 61 2620.72 1312 3232 2621.33 2372 2861 106225 106225 0.00%
crit 18.81% 9.39 2 21 5237.39 2625 6463 5247.20 3953 6217 49212 49212 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:28.27
    havoc
    [S]:11.10
  • if_expr:cast_time<havoc_remains
Rain of Fire 970 10.5% 18.4 15.40sec 15628 12590 Periodic 436.6 553 1105 659 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.42 0.00 0.00 436.61 1.2414 0.0000 287933.24 287933.24 0.00% 12590.00 12590.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.70% 352.35 252 474 552.83 507 599 552.84 546 559 194789 194789 0.00%
crit 19.30% 84.27 49 139 1105.33 1013 1198 1105.40 1086 1127 93144 93144 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:6.52
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.89
Scouring Tithe 331 3.6% 13.3 22.47sec 7395 4401 Direct 18.7 1480 2980 1776 19.7%
Periodic 132.7 413 827 493 19.2% 36.5%

Stats Details: Scouring Tithe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.33 18.69 132.70 132.70 1.6805 2.4559 98538.83 98538.83 0.00% 282.93 4400.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.26% 15.00 8 22 1479.94 1004 1674 1481.02 1362 1618 22201 22201 0.00%
crit 19.74% 3.69 0 11 2979.55 2009 3348 2902.21 0 3348 10999 10999 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.82% 107.25 72 146 413.10 123 419 413.08 410 416 44303 44303 0.00%
crit 19.18% 25.45 9 48 826.60 246 837 826.63 795 837 21036 21036 0.00%

Action Details: Scouring Tithe

  • id:312321
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.150000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:312321
  • name:Scouring Tithe
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Deal {$s1=0 + 60.0%} Arcane damage instantly, and $o2 over {$d=18 seconds}. If the enemy dies while affected by Scouring Tithe, you generate $?a137043[${{$s3=50}/10}]?a137044[${{$s4=50}/10}][${{$s5=50}/10}] Soul $LShard:Shards;. If they survive, Scouring Tithe's cooldown is refreshed.

Action Priority List

    aoe
    [K]:6.64
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    havoc
    [P]:6.77
Soul Fire 482 5.2% 5.5 49.42sec 25945 7461 Direct 7.4 16252 32488 19460 19.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.36 0.00 0.00 3.4775 0.0000 143455.12 143455.12 0.00% 7461.13 7461.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.08% 5.89 1 11 16251.96 8615 21177 16289.94 13578 19844 95766 95766 0.00%
crit 19.92% 1.47 0 5 32487.78 17200 42336 26243.36 0 42336 47689 47689 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.71
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.90
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.54sec 11992 10374 Direct 6.0 3348 6696 3991 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23984.13 23984.13 0.00% 10373.76 10373.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 4.84 2 6 3348.13 3348 3348 3348.13 3348 3348 16193 16193 0.00%
crit 19.39% 1.16 0 4 6696.27 6696 6696 4821.75 0 6696 7791 7791 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3509 / 717
Immolation 3245 7.1% 39.0 5.49sec 4992 0 Direct 117.0 1395 2790 1664 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194687.10 194687.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 94.44 80 108 1395.06 1395 1395 1395.06 1395 1395 131756 131756 0.00%
crit 19.28% 22.56 9 37 2790.11 2790 2790 2790.11 2790 2790 62931 62931 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 387 269 Direct 41.0 326 651 387 18.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15874.09 22674.56 29.99% 269.49 269.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.07% 33.24 24 40 325.55 326 326 325.55 326 326 10821 15457 29.99%
crit 18.93% 7.76 1 17 651.10 651 651 651.10 651 651 5053 7218 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.6% 92.6 3.21sec 1651 1135 Direct 91.9 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152927.96 152927.96 0.00% 1134.56 1134.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.13 52 96 1395.06 1395 1395 1395.06 1395 1395 103410 103410 0.00%
crit 19.32% 17.75 8 32 2790.11 2790 2790 2790.11 2790 2790 49518 49518 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Kyrian_SoulTithe
Havoc 9.6 32.08sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.58
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.5 0.0 8.0sec 8.0sec 4.5sec 54.95% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.7s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.95%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Tithe 0.8 0.3 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.3 (0.3) 0.0

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_soul_tithe
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:340238
  • name:Soul Tithe
  • tooltip:Gaining $w1% increased damage from your $?c1[Malefic Rapture][]$?c2[demons][]$?c3[Chaos Bolt][].
  • description:{$@spelldesc340229=When a target dies under the effect of Scouring Tithe, gain |cFFFFFFFF${{$s1=10}}.1%|r increased damage to your $?c1[Malefic Rapture][]$?c2[demons][]$?c3[Chaos Bolt][] for {$340238d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Kyrian_SoulTithe_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.7s
  • trigger_min/max:180.0s / 184.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Kyrian_SoulTithe_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.7s
  • trigger_min/max:180.0s / 184.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 10.92% 7.67% 13.62% 0.7s 0.0s 6.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_SoulTithe
soul_fire Soul Shard 6.54 6.89 7.34% 1.05 0.54 7.31%
immolate Soul Shard 344.14 33.16 35.35% 0.10 1.25 3.64%
incinerate Soul Shard 39.18 10.01 10.67% 0.26 0.03 0.34%
conflagrate Soul Shard 36.54 27.21 29.00% 0.74 0.00 0.00%
mana_regen Mana 655.10 120616.35 100.00% 184.12 27923.63 18.80%
immolate_crits Soul Shard 33.13 3.19 3.40% 0.10 0.12 3.64%
incinerate_crits Soul Shard 9.38 0.94 1.00% 0.10 0.00 0.17%
infernal Soul Shard 120.00 10.32 11.00% 0.09 1.68 13.97%
souring_tithe Soul Shard 1.02 2.09 2.23% 2.04 3.03 59.16%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 405.27 408.15 27919.6 49142.8 47635.5 50000.0
Soul Shard 4.0 0.32 0.31 6.6 4.4 0.0 5.0
Usage Type Count Total Avg RPE APR
Kyrian_SoulTithe
cataclysm Mana 9.6 4823.3 500.0 500.5 48.1
channel_demonfire Mana 11.8 8862.8 750.0 750.2 33.4
chaos_bolt Soul Shard 18.6 37.2 2.0 2.0 11420.5
conflagrate Mana 36.5 18270.5 500.0 499.9 12.9
havoc Mana 9.6 9578.9 1000.0 1000.5 0.0
immolate Mana 25.2 18889.6 750.0 750.3 25.0
incinerate Mana 39.2 39183.0 1000.0 999.9 4.0
rain_of_fire Soul Shard 18.4 55.2 3.0 3.0 5214.2
scouring_tithe Mana 13.3 13326.5 1000.0 1000.1 7.4
soul_fire Mana 6.5 6541.0 1000.0 1183.0 21.9
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Kyrian_SoulTithe Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Kyrian_SoulTithe Damage Per Second
Count 618
Mean 9205.12
Minimum 8762.66
Maximum 9772.51
Spread ( max - min ) 1009.85
Range [ ( max - min ) / 2 * 100% ] 5.49%
Standard Deviation 203.6433
5th Percentile 8890.44
95th Percentile 9551.55
( 95th Percentile - 5th Percentile ) 661.12
Mean Distribution
Standard Deviation 8.1917
95.00% Confidence Interval ( 9189.06 - 9221.17 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1881
0.1 Scale Factor Error with Delta=300 355
0.05 Scale Factor Error with Delta=300 1417
0.01 Scale Factor Error with Delta=300 35402
Priority Target DPS
Kyrian_SoulTithe Priority Target Damage Per Second
Count 618
Mean 4969.36
Minimum 4644.26
Maximum 5346.02
Spread ( max - min ) 701.76
Range [ ( max - min ) / 2 * 100% ] 7.06%
Standard Deviation 120.9363
5th Percentile 4786.80
95th Percentile 5175.01
( 95th Percentile - 5th Percentile ) 388.21
Mean Distribution
Standard Deviation 4.8648
95.00% Confidence Interval ( 4959.83 - 4978.90 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2276
0.1 Scale Factor Error with Delta=300 125
0.05 Scale Factor Error with Delta=300 500
0.01 Scale Factor Error with Delta=300 12486
DPS(e)
Kyrian_SoulTithe Damage Per Second (Effective)
Count 618
Mean 9205.12
Minimum 8762.66
Maximum 9772.51
Spread ( max - min ) 1009.85
Range [ ( max - min ) / 2 * 100% ] 5.49%
Damage
Kyrian_SoulTithe Damage
Count 618
Mean 2370083.66
Minimum 1876187.36
Maximum 2874970.34
Spread ( max - min ) 998782.98
Range [ ( max - min ) / 2 * 100% ] 21.07%
DTPS
Kyrian_SoulTithe Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_SoulTithe Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_SoulTithe Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_SoulTithe Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_SoulTithe Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_SoulTithe Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_SoulTitheTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_SoulTithe Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.71 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 6.52 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.82 channel_demonfire,if=dot.immolate.remains>cast_time
F 17.54 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.58 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.89 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.66 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
K 6.64 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 28.27 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 17.88 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.90 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
P 6.77 scouring_tithe
Q 7.74 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
R 18.69 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
S 11.10 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHPRNRNQRNDFLEDFFJKLDJLJADLHNRSSRQP9EFJILJLJLAHPRNRSQEJILFLJKLFILA9EHNRNPRNQIFLLJELIAJKLHSRSNQR9EFIFJKLAJLHNRRQNREKFFFMJLDLJA9EHPRNRNQDFLJILEKAJLLHRNRQSSN9EFFIJKAILHSNRSNQSEIFJKLLLIJALHORNPSEIJLFIFF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.892 cds M summon_infernal Fluffy_Pillow 49696.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.900 aoe H havoc enemy2 49200.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.905 havoc P scouring_tithe Fluffy_Pillow 48702.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.245 havoc R chaos_bolt Fluffy_Pillow 48372.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:09.253 havoc N conflagrate Fluffy_Pillow 49376.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:10.260 havoc R chaos_bolt Fluffy_Pillow 49380.0/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:11.666 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:12.673 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.679 havoc R chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:15.087 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:16.094 aoe D rain_of_fire Fluffy_Pillow 49959.5/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.102 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:18.106 aoe L incinerate Fluffy_Pillow 49251.0/50000: 99% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:19.047 aoe E channel_demonfire Fluffy_Pillow 48721.5/50000: 97% mana
2.7/5: 54% soul_shard
bloodlust
0:21.300 aoe D rain_of_fire Fluffy_Pillow 49098.0/50000: 98% mana
3.4/5: 68% soul_shard
bloodlust
0:22.307 aoe F immolate enemy2 49601.5/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust
0:23.313 aoe F immolate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
bloodlust
0:24.321 aoe J conflagrate Fluffy_Pillow 49006.0/50000: 98% mana
1.6/5: 32% soul_shard
bloodlust
0:25.328 aoe K scouring_tithe Fluffy_Pillow 49009.5/50000: 98% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:26.668 aoe L incinerate Fluffy_Pillow 48679.5/50000: 97% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:27.606 aoe D rain_of_fire Fluffy_Pillow 48148.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:28.613 aoe J conflagrate Fluffy_Pillow 48652.0/50000: 97% mana
0.8/5: 16% soul_shard
bloodlust
0:29.619 aoe L incinerate Fluffy_Pillow 48655.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:30.557 aoe J conflagrate Fluffy_Pillow 48124.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust
0:31.565 default A cataclysm Fluffy_Pillow 48128.0/50000: 96% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:33.074 aoe D rain_of_fire Fluffy_Pillow 48382.5/50000: 97% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:34.080 aoe L incinerate Fluffy_Pillow 48885.5/50000: 98% mana
1.1/5: 22% soul_shard
bloodlust, backdraft
0:35.019 aoe H havoc enemy2 48355.0/50000: 97% mana
1.3/5: 26% soul_shard
bloodlust
0:36.025 havoc N conflagrate Fluffy_Pillow 47858.0/50000: 96% mana
1.7/5: 34% soul_shard
bloodlust
0:37.033 havoc R chaos_bolt Fluffy_Pillow 47862.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:38.440 havoc S incinerate Fluffy_Pillow 48565.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:39.780 havoc S incinerate Fluffy_Pillow 48235.5/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust
0:41.121 havoc R chaos_bolt Fluffy_Pillow 47906.0/50000: 96% mana
2.3/5: 46% soul_shard
0:43.731 havoc Q immolate Fluffy_Pillow 49211.0/50000: 98% mana
0.6/5: 12% soul_shard
0:45.038 havoc P scouring_tithe Fluffy_Pillow 49114.5/50000: 98% mana
0.9/5: 18% soul_shard
0:46.779 default 9 soul_fire Fluffy_Pillow 48985.0/50000: 98% mana
0.9/5: 18% soul_shard
0:50.256 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:53.126 aoe F immolate enemy3 49687.0/50000: 99% mana
2.8/5: 56% soul_shard
0:54.433 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
0:55.739 aoe I rain_of_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
0:57.047 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
0:58.266 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
0:59.572 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:00.792 aoe J conflagrate Fluffy_Pillow 48765.0/50000: 98% mana
2.1/5: 42% soul_shard
1:02.097 aoe L incinerate Fluffy_Pillow 48917.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:03.317 default A cataclysm Fluffy_Pillow 48527.5/50000: 97% mana
3.3/5: 66% soul_shard
1:05.057 aoe H havoc enemy2 48897.5/50000: 98% mana
3.6/5: 72% soul_shard
1:06.363 havoc P scouring_tithe Fluffy_Pillow 48550.5/50000: 97% mana
3.8/5: 76% soul_shard
1:08.104 havoc R chaos_bolt Fluffy_Pillow 48421.0/50000: 97% mana
4.1/5: 82% soul_shard
1:10.713 havoc N conflagrate Fluffy_Pillow 49725.5/50000: 99% mana
2.4/5: 48% soul_shard
1:12.020 havoc R chaos_bolt Fluffy_Pillow 49879.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:13.846 havoc S incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:15.587 havoc Q immolate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
1:16.894 aoe E channel_demonfire Fluffy_Pillow 48906.0/50000: 98% mana
2.6/5: 52% soul_shard
1:19.748 aoe J conflagrate Fluffy_Pillow 49583.0/50000: 99% mana
2.9/5: 58% soul_shard
1:21.054 aoe I rain_of_fire Fluffy_Pillow 49736.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:22.360 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
1:23.580 aoe F immolate enemy3 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:24.887 aoe L incinerate Fluffy_Pillow 48906.0/50000: 98% mana
1.2/5: 24% soul_shard
1:26.629 aoe J conflagrate Fluffy_Pillow 48777.0/50000: 98% mana
1.6/5: 32% soul_shard
1:27.936 aoe K scouring_tithe Fluffy_Pillow 48930.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:29.674 aoe L incinerate Fluffy_Pillow 48799.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:30.893 aoe F immolate enemy2 48409.0/50000: 97% mana
2.8/5: 56% soul_shard
1:32.198 aoe I rain_of_fire Fluffy_Pillow 48311.5/50000: 97% mana
3.0/5: 60% soul_shard
1:33.502 aoe L incinerate Fluffy_Pillow 48963.5/50000: 98% mana
0.2/5: 4% soul_shard
1:35.243 default A cataclysm Fluffy_Pillow 48834.0/50000: 98% mana
0.7/5: 14% soul_shard
1:36.982 default 9 soul_fire Fluffy_Pillow 49203.5/50000: 98% mana
1.2/5: 24% soul_shard
1:40.461 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.6/5: 52% soul_shard
1:43.258 aoe H havoc enemy2 49651.5/50000: 99% mana
3.0/5: 60% soul_shard
1:44.565 havoc N conflagrate Fluffy_Pillow 49305.0/50000: 99% mana
3.1/5: 62% soul_shard
1:45.871 havoc R chaos_bolt Fluffy_Pillow 49458.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:47.697 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:49.005 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
1:50.747 havoc R chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
1:52.575 havoc N conflagrate Fluffy_Pillow 49917.0/50000: 100% mana
2.3/5: 46% soul_shard
1:53.882 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:55.190 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:56.497 aoe F immolate enemy3 49906.5/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
1:57.803 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
1:59.023 aoe L incinerate Fluffy_Pillow 48862.0/50000: 98% mana
1.3/5: 26% soul_shard
2:00.765 aoe J conflagrate Fluffy_Pillow 48733.0/50000: 97% mana
1.9/5: 38% soul_shard
2:02.122 aoe E channel_demonfire Fluffy_Pillow 48911.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:04.993 aoe L incinerate Fluffy_Pillow 49597.0/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
2:06.210 aoe I rain_of_fire Fluffy_Pillow 49001.0/50000: 98% mana
3.2/5: 64% soul_shard
2:07.516 default A cataclysm Fluffy_Pillow 49654.0/50000: 99% mana
0.2/5: 4% soul_shard
2:09.257 aoe J conflagrate Fluffy_Pillow 49502.5/50000: 99% mana
0.5/5: 10% soul_shard
2:10.770 aoe K scouring_tithe Fluffy_Pillow 49759.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:12.511 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:13.730 aoe H havoc enemy2 48612.0/50000: 97% mana
1.8/5: 36% soul_shard
2:15.036 havoc S incinerate Fluffy_Pillow 48265.0/50000: 97% mana
1.8/5: 36% soul_shard
2:16.777 havoc R chaos_bolt Fluffy_Pillow 48135.5/50000: 96% mana
2.6/5: 52% soul_shard
2:19.387 havoc S incinerate Fluffy_Pillow 49440.5/50000: 99% mana
0.9/5: 18% soul_shard
2:21.129 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
2:22.435 havoc Q immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:23.742 havoc R chaos_bolt Fluffy_Pillow 49059.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:25.570 default 9 soul_fire Fluffy_Pillow 49973.5/50000: 100% mana
1.0/5: 20% soul_shard
2:29.048 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
2:31.820 aoe F immolate enemy3 49638.5/50000: 99% mana
2.9/5: 58% soul_shard
2:33.126 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
2:34.432 aoe F immolate enemy2 49905.0/50000: 100% mana
0.2/5: 4% soul_shard
2:35.739 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
0.3/5: 6% soul_shard
2:37.047 aoe K scouring_tithe Fluffy_Pillow 49406.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
2:38.789 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:40.009 default A cataclysm Fluffy_Pillow 48613.0/50000: 97% mana
1.6/5: 32% soul_shard
2:41.750 aoe J conflagrate Fluffy_Pillow 48983.5/50000: 98% mana
1.8/5: 36% soul_shard
2:43.057 aoe L incinerate Fluffy_Pillow 49137.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:44.276 aoe H havoc enemy2 48746.5/50000: 97% mana
2.9/5: 58% soul_shard
2:45.583 havoc N conflagrate Fluffy_Pillow 48400.0/50000: 97% mana
3.1/5: 62% soul_shard
2:46.890 havoc R chaos_bolt Fluffy_Pillow 48553.5/50000: 97% mana
4.2/5: 84% soul_shard
backdraft
2:48.716 havoc R chaos_bolt Fluffy_Pillow 49466.5/50000: 99% mana
2.4/5: 48% soul_shard
2:51.326 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:52.632 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
2:54.015 havoc R chaos_bolt Fluffy_Pillow 49443.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
2:55.843 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:58.677 aoe K scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:00.417 aoe F immolate enemy3 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
3:01.724 aoe F immolate enemy2 48905.5/50000: 98% mana
0.9/5: 18% soul_shard
3:03.029 aoe F immolate Fluffy_Pillow 48808.0/50000: 98% mana
1.2/5: 24% soul_shard
3:04.335 cds M summon_infernal Fluffy_Pillow 48711.0/50000: 97% mana
1.2/5: 24% soul_shard
3:05.640 aoe J conflagrate Fluffy_Pillow 48363.5/50000: 97% mana
1.7/5: 34% soul_shard
3:06.947 aoe L incinerate Fluffy_Pillow 48517.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft
3:08.167 aoe D rain_of_fire Fluffy_Pillow 48127.0/50000: 96% mana
3.2/5: 64% soul_shard
3:09.473 aoe L incinerate Fluffy_Pillow 48780.0/50000: 98% mana
0.5/5: 10% soul_shard
3:11.212 aoe J conflagrate Fluffy_Pillow 48649.5/50000: 97% mana
1.3/5: 26% soul_shard
3:12.518 default A cataclysm Fluffy_Pillow 48802.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
3:14.259 default 9 soul_fire Fluffy_Pillow 49173.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:17.737 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
3:20.570 aoe H havoc enemy2 49669.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:21.876 havoc P scouring_tithe Fluffy_Pillow 49322.0/50000: 99% mana
5.0/5: 100% soul_shard
3:23.616 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
3:26.225 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.533 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:29.362 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:30.667 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:31.974 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
3:33.282 aoe F immolate enemy3 49906.5/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
3:34.589 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
3:35.808 aoe J conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.8/5: 56% soul_shard
3:37.259 aoe I rain_of_fire Fluffy_Pillow 49087.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
3:38.565 aoe L incinerate Fluffy_Pillow 49740.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
3:39.784 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
3:42.591 aoe K scouring_tithe Fluffy_Pillow 49655.5/50000: 99% mana
1.4/5: 28% soul_shard
3:44.331 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
3:46.070 aoe J conflagrate Fluffy_Pillow 49371.5/50000: 99% mana
1.8/5: 36% soul_shard
3:47.376 aoe L incinerate Fluffy_Pillow 49524.5/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
3:48.595 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
3:50.335 aoe H havoc enemy2 48872.0/50000: 98% mana
3.2/5: 64% soul_shard
3:51.874 havoc R chaos_bolt Fluffy_Pillow 48641.5/50000: 97% mana
3.3/5: 66% soul_shard
3:54.483 havoc N conflagrate Fluffy_Pillow 49946.0/50000: 100% mana
1.6/5: 32% soul_shard
3:55.790 havoc R chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
3:57.617 havoc Q immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
3:58.924 havoc S incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
4:00.665 havoc S incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
4:02.405 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.4/5: 48% soul_shard
4:03.712 default 9 soul_fire Fluffy_Pillow 49026.0/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:07.189 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:10.052 aoe F immolate enemy3 49683.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:11.358 aoe F immolate enemy2 49252.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:12.664 aoe I rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
5.0/5: 100% soul_shard
4:13.971 aoe J conflagrate Fluffy_Pillow 49808.5/50000: 100% mana
2.3/5: 46% soul_shard
4:15.277 aoe K scouring_tithe Fluffy_Pillow 49961.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
4:17.018 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:18.758 aoe I rain_of_fire Fluffy_Pillow 49372.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
4:20.064 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
4:21.282 aoe H havoc enemy2 49001.5/50000: 98% mana
0.7/5: 14% soul_shard
4:22.590 havoc S incinerate Fluffy_Pillow 48655.5/50000: 97% mana
0.9/5: 18% soul_shard
4:24.330 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
1.6/5: 32% soul_shard
4:25.638 havoc R chaos_bolt Fluffy_Pillow 48679.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
4:27.467 havoc S incinerate Fluffy_Pillow 49594.0/50000: 99% mana
1.1/5: 22% soul_shard
4:29.208 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:30.514 havoc Q immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:31.820 havoc S incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
4:33.039 aoe E channel_demonfire Fluffy_Pillow 48668.0/50000: 97% mana
3.5/5: 70% soul_shard
4:35.912 aoe I rain_of_fire Fluffy_Pillow 49354.5/50000: 99% mana
3.9/5: 78% soul_shard
4:37.219 aoe F immolate enemy3 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:38.527 aoe J conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
4:39.832 aoe K scouring_tithe Fluffy_Pillow 49405.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
4:41.573 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
4:42.794 aoe L incinerate Fluffy_Pillow 48613.0/50000: 97% mana
2.5/5: 50% soul_shard
4:44.534 aoe L incinerate Fluffy_Pillow 48483.0/50000: 97% mana
2.7/5: 54% soul_shard
4:46.275 aoe I rain_of_fire Fluffy_Pillow 48353.5/50000: 97% mana
3.2/5: 64% soul_shard
4:47.581 aoe J conflagrate Fluffy_Pillow 49006.5/50000: 98% mana
0.4/5: 8% soul_shard
4:48.889 default A cataclysm Fluffy_Pillow 49160.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
4:50.629 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
4:51.849 aoe H havoc enemy2 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:53.155 havoc O soul_fire Fluffy_Pillow 48655.5/50000: 97% mana
1.9/5: 38% soul_shard
4:56.632 havoc R chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
4:59.242 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
5:00.548 havoc P scouring_tithe Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
5:02.287 havoc S incinerate Fluffy_Pillow 49001.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
5:03.506 aoe E channel_demonfire Fluffy_Pillow 48611.0/50000: 97% mana
4.6/5: 92% soul_shard
5:06.281 aoe I rain_of_fire Fluffy_Pillow 49248.5/50000: 98% mana
4.9/5: 98% soul_shard
5:07.589 aoe J conflagrate Fluffy_Pillow 49902.5/50000: 100% mana
1.9/5: 38% soul_shard
5:08.895 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
5:10.113 aoe F immolate enemy3 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
5:11.419 aoe I rain_of_fire Fluffy_Pillow 48904.5/50000: 98% mana
3.2/5: 64% soul_shard
5:12.725 aoe F immolate Fluffy_Pillow 49557.5/50000: 99% mana
0.3/5: 6% soul_shard
5:14.031 aoe F immolate enemy2 49252.0/50000: 99% mana
0.7/5: 14% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Kyrian_SoulTithe"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=kyrian
soulbind=217:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NF_AshenRemains : 9657 dps, 5182 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9656.6 9656.6 17.1 / 0.177% 801.6 / 8.3% 21.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
389.2 386.5 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NF_AshenRemains 9657
Cataclysm 777 8.1% 9.6 32.33sec 24016 14136 Direct 28.9 6704 13384 8002 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 28.87 0.00 0.00 1.6990 0.0000 231145.51 231145.51 0.00% 14136.48 14136.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 23.25 14 33 6703.52 6141 7261 6703.59 6512 6909 155853 155853 0.00%
crit 19.49% 5.63 0 15 13383.57 12283 14521 13355.36 0 14489 75293 75293 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.69
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1021) 0.0% (10.6%) 11.9 25.73sec 25467 9465

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.91 0.00 177.75 0.00 2.6908 0.1633 0.00 0.00 0.00% 9464.77 9464.77

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.90
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1021 10.6% 0.0 0.00sec 0 0 Direct 533.2 476 956 569 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 533.25 0.00 0.00 0.0000 0.0000 303260.79 303260.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 430.57 315 552 476.39 263 976 476.63 447 506 205123 205123 0.00%
crit 19.25% 102.67 63 145 956.13 525 1952 956.33 830 1084 98137 98137 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1300 (1747) 13.5% (18.1%) 21.5 13.42sec 24161 12346 Direct 42.7 (85.1) 0 9033 9033 100.0% (59.6%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.46 42.71 0.00 0.00 1.9571 0.0000 385775.08 385775.08 0.00% 12345.59 12345.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.71 32 56 9032.64 5864 12241 9032.01 8783 9241 385775 385775 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.57
  • if_expr:cast_time<havoc_remains
    Internal Combustion 447 4.6% 42.4 13.39sec 3129 0 Direct 42.4 2630 5263 3130 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.41 42.41 0.00 0.00 0.0000 0.0000 132715.20 132715.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 34.35 20 48 2629.62 1 3714 2631.96 2399 2814 90331 90331 0.00%
crit 19.00% 8.06 1 17 5262.72 208 7428 5258.91 3094 7052 42384 42384 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 807 8.4% 36.6 7.95sec 6539 5230 Direct 56.1 3587 7183 4268 18.9%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.65 56.15 0.00 0.00 1.2503 0.0000 239663.37 239663.37 0.00% 5230.20 5230.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 45.51 29 61 3587.36 2047 5042 3588.51 3378 3798 163302 163302 0.00%
crit 18.94% 10.63 3 20 7182.69 4094 10084 7180.81 5260 9356 76361 76361 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.15
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.51
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1607 16.7% 26.4 10.78sec 18075 14333 Direct 33.6 1528 3057 1813 18.6%
Periodic 344.8 1014 2028 1210 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.44 33.59 344.77 344.77 1.2611 2.4825 478000.59 478000.59 0.00% 537.53 14332.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.40% 27.34 18 40 1527.82 820 2017 1528.62 1407 1652 41778 41778 0.00%
crit 18.60% 6.25 1 16 3057.35 1644 4034 3051.45 2070 3854 19082 19082 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 278.19 214 349 1014.25 0 1261 1014.28 991 1038 282146 282146 0.00%
crit 19.31% 66.58 40 99 2027.52 1 2521 2027.82 1907 2131 134994 134994 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.83
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.72
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 615 6.4% 44.5 6.11sec 4124 2816 Direct 55.1 (55.1) 2796 5597 3330 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.48 55.07 0.00 0.00 1.4644 0.0000 183403.88 183403.88 0.00% 2815.97 2815.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 44.56 27 66 2795.57 1314 3426 2798.87 2596 3009 124596 124596 0.00%
crit 19.09% 10.51 1 24 5597.45 2650 6851 5600.90 4536 6560 58808 58808 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.74
    havoc
    [R]:10.99
  • if_expr:cast_time<havoc_remains
Rain of Fire 916 9.5% 17.4 16.18sec 15633 12543 Periodic 413.1 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.42 0.00 0.00 413.06 1.2464 0.0000 272289.72 272289.72 0.00% 12542.71 12542.71
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.78% 333.67 215 467 552.91 507 599 552.92 545 561 184496 184496 0.00%
crit 19.22% 79.39 47 126 1105.77 1013 1198 1105.91 1082 1128 87794 87794 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.32
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.11
Soul Fire 515 5.3% 5.5 49.46sec 27666 7956 Direct 7.8 16373 32607 19524 19.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.83 0.00 0.00 3.4775 0.0000 152969.23 152969.23 0.00% 7955.96 7955.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 6.31 1 11 16373.30 8603 21176 16434.96 13566 20176 103246 103246 0.00%
crit 19.45% 1.52 0 6 32607.43 17292 42352 26723.08 0 42295 49723 49723 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.24
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.38
  • if_expr:cast_time<havoc_remains
Soul Rot 339 3.5% 5.2 62.60sec 19310 15460 Periodic 96.0 883 1768 1052 19.1% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.23 0.00 95.96 95.96 1.2491 1.2896 100923.90 100923.90 0.00% 774.66 15460.16
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.91% 77.64 54 101 882.67 424 1395 883.11 828 930 68538 68538 0.00%
crit 19.09% 18.32 7 37 1768.39 849 2790 1770.60 1348 2229 32386 32386 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.24
Summon Infernal 82 0.8% 2.0 180.67sec 12008 10388 Direct 6.0 3348 6696 3997 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24016.64 24016.64 0.00% 10387.82 10387.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 4.83 1 6 3348.13 3348 3348 3348.13 3348 3348 16161 16161 0.00%
crit 19.55% 1.17 0 5 6696.27 6696 6696 5005.95 0 6696 7856 7856 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3505 / 716
Immolation 3241 6.8% 39.0 5.50sec 4986 0 Direct 117.0 1395 2790 1662 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194436.53 194436.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 94.62 81 107 1395.06 1395 1395 1395.06 1395 1395 132007 132007 0.00%
crit 19.12% 22.38 10 36 2790.11 2790 2790 2790.11 2790 2790 62430 62430 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 387 269 Direct 41.0 326 651 387 18.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15873.57 22673.80 29.99% 269.48 269.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.08% 33.24 25 41 325.55 326 326 325.55 326 326 10822 15458 29.99%
crit 18.92% 7.76 0 16 651.10 651 651 650.05 0 651 5052 7216 29.94%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.3% 92.6 3.21sec 1652 1135 Direct 91.9 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 153020.51 153020.51 0.00% 1135.25 1135.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 74.06 50 97 1395.06 1395 1395 1395.06 1395 1395 103318 103318 0.00%
crit 19.39% 17.81 6 31 2790.11 2790 2790 2790.11 2790 2790 49703 49703 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
NF_AshenRemains
Havoc 9.6 31.99sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.60
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 7.9sec 7.9sec 4.1sec 50.40% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 24.1s
  • trigger_min/max:2.0s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.40%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.2 0.0 62.5sec 62.5sec 7.9sec 13.90% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.8s
  • trigger_min/max:61.3s / 68.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.90%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NF_AshenRemains_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NF_AshenRemains_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.0s
  • trigger_min/max:180.0s / 185.0s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.20% 10.82% 17.05% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NF_AshenRemains
soul_fire Soul Shard 6.54 7.15 7.57% 1.09 0.75 9.52%
immolate Soul Shard 344.86 33.35 35.29% 0.10 1.13 3.28%
incinerate Soul Shard 44.53 11.08 11.73% 0.25 0.01 0.06%
conflagrate Soul Shard 36.65 28.08 29.71% 0.77 0.00 0.00%
mana_regen Mana 654.23 115058.52 100.00% 175.87 33459.55 22.53%
immolate_crits Soul Shard 33.48 3.24 3.43% 0.10 0.11 3.20%
incinerate_crits Soul Shard 10.52 1.05 1.11% 0.10 0.00 0.04%
infernal Soul Shard 120.00 10.55 11.17% 0.09 1.45 12.06%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.49 389.17 33480.5 49203.1 47742.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NF_AshenRemains
cataclysm Mana 9.6 4817.0 500.0 500.5 48.0
channel_demonfire Mana 11.9 8926.7 750.0 749.6 34.0
chaos_bolt Soul Shard 21.4 42.9 2.0 2.0 12092.5
conflagrate Mana 36.7 18325.7 500.0 500.0 13.1
havoc Mana 9.6 9596.2 1000.0 1000.8 0.0
immolate Mana 26.4 19819.4 750.0 749.5 24.1
incinerate Mana 44.5 44525.2 1000.0 1001.1 4.1
rain_of_fire Soul Shard 17.4 52.3 3.0 3.0 5207.1
soul_fire Mana 6.5 6539.4 1000.0 1182.7 23.4
soul_rot Mana 5.2 1305.2 250.0 249.7 77.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NF_AshenRemains Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
NF_AshenRemains Damage Per Second
Count 618
Mean 9656.56
Minimum 9088.10
Maximum 10194.01
Spread ( max - min ) 1105.91
Range [ ( max - min ) / 2 * 100% ] 5.73%
Standard Deviation 217.3730
5th Percentile 9318.79
95th Percentile 10032.57
( 95th Percentile - 5th Percentile ) 713.78
Mean Distribution
Standard Deviation 8.7440
95.00% Confidence Interval ( 9639.43 - 9673.70 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1947
0.1 Scale Factor Error with Delta=300 404
0.05 Scale Factor Error with Delta=300 1614
0.01 Scale Factor Error with Delta=300 40337
Priority Target DPS
NF_AshenRemains Priority Target Damage Per Second
Count 618
Mean 5182.07
Minimum 4849.96
Maximum 5551.21
Spread ( max - min ) 701.25
Range [ ( max - min ) / 2 * 100% ] 6.77%
Standard Deviation 130.0273
5th Percentile 4981.40
95th Percentile 5401.78
( 95th Percentile - 5th Percentile ) 420.38
Mean Distribution
Standard Deviation 5.2305
95.00% Confidence Interval ( 5171.82 - 5192.32 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2419
0.1 Scale Factor Error with Delta=300 145
0.05 Scale Factor Error with Delta=300 578
0.01 Scale Factor Error with Delta=300 14433
DPS(e)
NF_AshenRemains Damage Per Second (Effective)
Count 618
Mean 9656.56
Minimum 9088.10
Maximum 10194.01
Spread ( max - min ) 1105.91
Range [ ( max - min ) / 2 * 100% ] 5.73%
Damage
NF_AshenRemains Damage
Count 618
Mean 2504163.90
Minimum 2016525.03
Maximum 3029917.40
Spread ( max - min ) 1013392.37
Range [ ( max - min ) / 2 * 100% ] 20.23%
DTPS
NF_AshenRemains Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NF_AshenRemains Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NF_AshenRemains Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NF_AshenRemains Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NF_AshenRemains Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NF_AshenRemains Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NF_AshenRemainsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NF_AshenRemains Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.24 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.69 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.32 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.24 soul_rot
F 11.90 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.83 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.60 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.11 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.15 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.74 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.51 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.38 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.72 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.57 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.99 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDGFGDGLKLLDKALLJIRNQRNPQ9FGJKLLKLAEIQNQRPRNFJGLKLJGLLA9INQNQRQPFGGKLKJLLAEINQRQPRNF9GGJKGLJAIRNQRNQPFGKLGLJKMLLLAEIOQNQNDFGDGGKLKJLLAINQRRNQPFGKL9GJKLJEAIRNQRRPNFJLLGKLJLLKLAIQNOPQFJKLGLKLGG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.869 cds M summon_infernal Fluffy_Pillow 49934.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.876 aoe I havoc enemy2 49438.0/50000: 99% mana
4.9/5: 98% soul_shard
bloodlust, soul_rot
0:06.883 havoc Q chaos_bolt Fluffy_Pillow 48941.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.892 havoc N conflagrate Fluffy_Pillow 49946.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.898 havoc Q chaos_bolt Fluffy_Pillow 49949.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.304 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.311 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.316 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:14.723 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.730 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.138 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.143 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:19.152 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.157 aoe F channel_demonfire Fluffy_Pillow 49251.5/50000: 99% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:22.392 aoe G immolate enemy2 49619.0/50000: 99% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.399 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.406 aoe G immolate enemy3 49756.0/50000: 100% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:25.412 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:26.353 aoe K conflagrate Fluffy_Pillow 48722.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.360 aoe L incinerate Fluffy_Pillow 48726.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.299 aoe L incinerate Fluffy_Pillow 48195.5/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:29.639 aoe D rain_of_fire Fluffy_Pillow 47865.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:30.646 aoe K conflagrate Fluffy_Pillow 48369.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:31.653 default A cataclysm Fluffy_Pillow 48372.5/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:33.079 aoe L incinerate Fluffy_Pillow 48585.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:34.017 aoe L incinerate Fluffy_Pillow 48054.5/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:35.357 aoe J rain_of_fire Fluffy_Pillow 47724.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.363 aoe I havoc enemy2 48227.5/50000: 96% mana
0.5/5: 10% soul_shard
bloodlust
0:37.370 havoc R incinerate Fluffy_Pillow 47731.0/50000: 95% mana
0.6/5: 12% soul_shard
bloodlust
0:38.709 havoc N conflagrate Fluffy_Pillow 47400.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust
0:39.713 havoc Q chaos_bolt Fluffy_Pillow 47402.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:41.119 havoc R incinerate Fluffy_Pillow 48105.5/50000: 96% mana
0.7/5: 14% soul_shard
0:42.860 havoc N conflagrate Fluffy_Pillow 47976.0/50000: 96% mana
1.4/5: 28% soul_shard
0:44.165 havoc P immolate Fluffy_Pillow 48128.5/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
0:45.471 havoc Q chaos_bolt Fluffy_Pillow 48031.5/50000: 96% mana
2.8/5: 56% soul_shard
backdraft
0:47.298 default 9 soul_fire Fluffy_Pillow 48945.0/50000: 98% mana
1.3/5: 26% soul_shard
0:50.775 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
0:53.592 aoe G immolate enemy3 49660.5/50000: 99% mana
2.9/5: 58% soul_shard
0:54.898 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
0:56.205 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.3/5: 6% soul_shard
0:57.512 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
0:58.732 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
1:00.472 aoe K conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
1:01.779 aoe L incinerate Fluffy_Pillow 49026.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:02.998 default A cataclysm Fluffy_Pillow 48635.5/50000: 97% mana
2.9/5: 58% soul_shard
1:04.813 aoe E soul_rot Fluffy_Pillow 49043.0/50000: 98% mana
3.1/5: 62% soul_shard
1:06.120 aoe I havoc enemy2 49446.5/50000: 99% mana
3.3/5: 66% soul_shard
soul_rot
1:07.669 havoc Q chaos_bolt Fluffy_Pillow 49221.0/50000: 98% mana
3.6/5: 72% soul_shard
soul_rot
1:10.278 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
soul_rot
1:11.584 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft, soul_rot
1:13.412 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
soul_rot
1:15.152 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
1:16.457 havoc R incinerate Fluffy_Pillow 48904.5/50000: 98% mana
2.1/5: 42% soul_shard
1:18.199 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.7/5: 54% soul_shard
1:19.506 aoe F channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
1:22.360 aoe J rain_of_fire Fluffy_Pillow 49606.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:23.666 aoe G immolate enemy3 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
1:24.972 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
1:26.192 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.1/5: 42% soul_shard
1:27.499 aoe L incinerate Fluffy_Pillow 49015.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:28.718 aoe J rain_of_fire Fluffy_Pillow 48625.0/50000: 97% mana
3.1/5: 62% soul_shard
1:30.025 aoe G immolate enemy2 49278.5/50000: 99% mana
0.2/5: 4% soul_shard
1:31.332 aoe L incinerate Fluffy_Pillow 49182.0/50000: 98% mana
0.4/5: 8% soul_shard
1:33.072 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
1:34.811 default A cataclysm Fluffy_Pillow 48871.5/50000: 98% mana
1.4/5: 28% soul_shard
1:36.549 default 9 soul_fire Fluffy_Pillow 49240.5/50000: 98% mana
1.6/5: 32% soul_shard
1:40.026 aoe I havoc enemy2 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
1:41.331 havoc N conflagrate Fluffy_Pillow 48654.5/50000: 97% mana
3.2/5: 64% soul_shard
1:42.638 havoc Q chaos_bolt Fluffy_Pillow 48808.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
1:44.466 havoc N conflagrate Fluffy_Pillow 49722.0/50000: 99% mana
2.7/5: 54% soul_shard
1:45.773 havoc Q chaos_bolt Fluffy_Pillow 49875.5/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
1:47.601 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
1:49.341 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
1:51.950 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:53.256 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
1:56.083 aoe G immolate enemy2 49915.5/50000: 100% mana
1.4/5: 28% soul_shard
1:57.390 aoe G immolate enemy3 49252.5/50000: 99% mana
1.6/5: 32% soul_shard
1:58.694 aoe K conflagrate Fluffy_Pillow 49154.5/50000: 98% mana
1.6/5: 32% soul_shard
2:00.001 aoe L incinerate Fluffy_Pillow 49308.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft
2:01.220 aoe K conflagrate Fluffy_Pillow 48917.5/50000: 98% mana
2.6/5: 52% soul_shard
2:02.528 aoe J rain_of_fire Fluffy_Pillow 49071.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:03.835 aoe L incinerate Fluffy_Pillow 49725.0/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
2:05.052 aoe L incinerate Fluffy_Pillow 49001.0/50000: 98% mana
0.8/5: 16% soul_shard
2:06.792 default A cataclysm Fluffy_Pillow 48871.0/50000: 98% mana
1.3/5: 26% soul_shard
2:08.531 aoe E soul_rot Fluffy_Pillow 49240.5/50000: 98% mana
1.7/5: 34% soul_shard
2:09.837 aoe I havoc enemy2 49643.5/50000: 99% mana
1.7/5: 34% soul_shard
soul_rot
2:11.333 havoc N conflagrate Fluffy_Pillow 49391.5/50000: 99% mana
2.1/5: 42% soul_shard
soul_rot
2:12.638 havoc Q chaos_bolt Fluffy_Pillow 49544.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
2:14.465 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
soul_rot
2:16.206 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
soul_rot
2:18.816 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:20.122 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
2:21.861 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
2:23.168 aoe F channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:25.998 default 9 soul_fire Fluffy_Pillow 49820.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
2:29.476 aoe G immolate enemy3 49002.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
2:30.783 aoe G immolate Fluffy_Pillow 48906.0/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
2:32.090 aoe J rain_of_fire Fluffy_Pillow 48809.5/50000: 98% mana
4.9/5: 98% soul_shard
2:33.396 aoe K conflagrate Fluffy_Pillow 49462.5/50000: 99% mana
1.9/5: 38% soul_shard
2:34.704 aoe G immolate enemy2 49616.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
2:36.011 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
2:37.232 aoe J rain_of_fire Fluffy_Pillow 48863.0/50000: 98% mana
3.2/5: 64% soul_shard
2:38.540 default A cataclysm Fluffy_Pillow 49517.0/50000: 99% mana
0.2/5: 4% soul_shard
2:40.281 aoe I havoc enemy2 49502.5/50000: 99% mana
0.5/5: 10% soul_shard
2:41.589 havoc R incinerate Fluffy_Pillow 49156.5/50000: 98% mana
0.6/5: 12% soul_shard
2:43.331 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.2/5: 24% soul_shard
2:44.637 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:46.465 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:48.205 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:49.513 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:51.339 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
2:52.647 aoe F channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
2:55.413 aoe G immolate enemy2 49886.0/50000: 100% mana
1.5/5: 30% soul_shard
2:56.720 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.6/5: 32% soul_shard
2:58.027 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
2:59.246 aoe G immolate enemy3 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
3:00.553 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
2.7/5: 54% soul_shard
3:02.295 aoe J rain_of_fire Fluffy_Pillow 48776.5/50000: 98% mana
3.2/5: 64% soul_shard
3:03.602 aoe K conflagrate Fluffy_Pillow 49430.0/50000: 99% mana
0.4/5: 8% soul_shard
3:04.908 cds M summon_infernal Fluffy_Pillow 49583.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:06.213 aoe L incinerate Fluffy_Pillow 49235.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
3:07.434 aoe L incinerate Fluffy_Pillow 48846.0/50000: 98% mana
2.2/5: 44% soul_shard
3:09.174 aoe L incinerate Fluffy_Pillow 48716.0/50000: 97% mana
2.8/5: 56% soul_shard
3:10.915 default A cataclysm Fluffy_Pillow 48586.5/50000: 97% mana
3.6/5: 72% soul_shard
3:12.656 aoe E soul_rot Fluffy_Pillow 48957.0/50000: 98% mana
4.2/5: 84% soul_shard
3:13.963 aoe I havoc enemy2 49360.5/50000: 99% mana
4.5/5: 90% soul_shard
soul_rot
3:15.269 havoc O soul_fire Fluffy_Pillow 49013.5/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot
3:18.747 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot
3:21.355 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
soul_rot
3:22.662 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
3:24.489 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.797 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.102 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
3:29.943 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
3:31.250 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
3:32.556 aoe G immolate enemy3 49905.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
3:33.862 aoe G immolate enemy2 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
3:35.169 aoe K conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
1.4/5: 28% soul_shard
3:36.475 aoe L incinerate Fluffy_Pillow 49308.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:37.694 aoe K conflagrate Fluffy_Pillow 48918.0/50000: 98% mana
2.4/5: 48% soul_shard
3:39.000 aoe J rain_of_fire Fluffy_Pillow 49071.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:40.304 aoe L incinerate Fluffy_Pillow 49723.0/50000: 99% mana
0.2/5: 4% soul_shard
backdraft
3:41.523 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
3:43.264 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
3:45.004 aoe I havoc enemy2 49242.5/50000: 98% mana
1.4/5: 28% soul_shard
3:46.311 havoc N conflagrate Fluffy_Pillow 48896.0/50000: 98% mana
1.5/5: 30% soul_shard
3:47.618 havoc Q chaos_bolt Fluffy_Pillow 49049.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:49.445 havoc R incinerate Fluffy_Pillow 49963.0/50000: 100% mana
1.0/5: 20% soul_shard
3:51.186 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
3:52.927 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.2/5: 44% soul_shard
3:54.233 havoc Q chaos_bolt Fluffy_Pillow 49026.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
3:56.060 havoc P immolate Fluffy_Pillow 49939.5/50000: 100% mana
1.7/5: 34% soul_shard
3:57.366 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.9/5: 38% soul_shard
4:00.197 aoe G immolate enemy2 49917.5/50000: 100% mana
2.2/5: 44% soul_shard
4:01.503 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
4:02.811 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
4:04.032 default 9 soul_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.1/5: 62% soul_shard
4:07.510 aoe G immolate enemy3 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
4:08.819 aoe J rain_of_fire Fluffy_Pillow 48907.0/50000: 98% mana
4.9/5: 98% soul_shard
4:10.125 aoe K conflagrate Fluffy_Pillow 49560.0/50000: 99% mana
2.1/5: 42% soul_shard
4:11.432 aoe L incinerate Fluffy_Pillow 49713.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:12.650 aoe J rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.2/5: 64% soul_shard
4:13.957 aoe E soul_rot Fluffy_Pillow 49655.0/50000: 99% mana
0.2/5: 4% soul_shard
4:15.265 default A cataclysm Fluffy_Pillow 49752.5/50000: 100% mana
0.5/5: 10% soul_shard
soul_rot
4:17.005 aoe I havoc enemy2 49502.0/50000: 99% mana
0.6/5: 12% soul_shard
soul_rot
4:18.311 havoc R incinerate Fluffy_Pillow 49155.0/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
4:20.052 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
soul_rot
4:21.359 havoc Q chaos_bolt Fluffy_Pillow 49156.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft, soul_rot
4:23.188 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
soul_rot
4:24.929 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
4:26.669 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
2.0/5: 40% soul_shard
4:27.975 havoc N conflagrate Fluffy_Pillow 48775.5/50000: 98% mana
2.2/5: 44% soul_shard
4:29.282 aoe F channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:32.093 aoe J rain_of_fire Fluffy_Pillow 49584.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
4:33.401 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
4:34.621 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
4:36.362 aoe G immolate enemy3 48873.0/50000: 98% mana
1.9/5: 38% soul_shard
4:37.668 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.1/5: 42% soul_shard
4:38.976 aoe L incinerate Fluffy_Pillow 48930.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:40.196 aoe J rain_of_fire Fluffy_Pillow 48540.0/50000: 97% mana
3.1/5: 62% soul_shard
4:41.503 aoe L incinerate Fluffy_Pillow 49193.5/50000: 98% mana
0.3/5: 6% soul_shard
4:43.244 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
4:44.984 aoe K conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
4:46.292 aoe L incinerate Fluffy_Pillow 49026.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:47.513 default A cataclysm Fluffy_Pillow 48637.0/50000: 97% mana
2.2/5: 44% soul_shard
4:49.253 aoe I havoc enemy2 49007.0/50000: 98% mana
2.5/5: 50% soul_shard
4:50.561 havoc Q chaos_bolt Fluffy_Pillow 48661.0/50000: 97% mana
2.6/5: 52% soul_shard
4:53.171 havoc N conflagrate Fluffy_Pillow 49966.0/50000: 100% mana
1.0/5: 20% soul_shard
4:54.634 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
4:58.111 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
4:59.417 havoc Q chaos_bolt Fluffy_Pillow 48905.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:01.245 aoe F channel_demonfire Fluffy_Pillow 49819.0/50000: 100% mana
2.9/5: 58% soul_shard
5:04.191 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
5:05.496 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
5:06.803 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
5:08.023 aoe G immolate enemy3 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
5:09.329 aoe L incinerate Fluffy_Pillow 48905.5/50000: 98% mana
1.7/5: 34% soul_shard
5:11.070 aoe K conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.0/5: 40% soul_shard
5:12.378 aoe L incinerate Fluffy_Pillow 48930.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
5:13.598 aoe G immolate Fluffy_Pillow 48540.0/50000: 97% mana
3.1/5: 62% soul_shard
5:14.905 aoe G immolate enemy2 48443.5/50000: 97% mana
3.3/5: 66% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NF_AshenRemains"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=211:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NF_CombustingEngine : 9703 dps, 5205 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9702.7 9702.7 17.5 / 0.181% 825.5 / 8.5% 21.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.7 386.1 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NF_CombustingEngine 9703
Cataclysm 776 8.0% 9.6 32.32sec 23988 14120 Direct 28.9 6705 13397 8005 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 28.87 0.00 0.00 1.6990 0.0000 230873.35 230873.35 0.00% 14119.83 14119.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 23.30 15 34 6705.36 6141 7261 6704.65 6527 6906 156257 156257 0.00%
crit 19.29% 5.57 0 13 13396.87 12284 14521 13335.33 0 14358 74616 74616 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1025) 0.0% (10.6%) 11.9 25.75sec 25505 9483

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.94 0.00 178.32 0.00 2.6895 0.1633 0.00 0.00 0.00% 9483.17 9483.17

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.93
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1025 10.6% 0.0 0.00sec 0 0 Direct 535.0 476 955 569 19.5%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 534.96 0.00 0.00 0.0000 0.0000 304571.11 304571.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 430.85 313 567 476.27 263 976 476.55 451 506 205199 205199 0.00%
crit 19.46% 104.11 55 150 954.91 525 1952 954.72 818 1098 99372 99372 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1230 (1735) 12.7% (17.9%) 21.5 13.36sec 23923 12204 Direct 42.8 (85.3) 0 8527 8527 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.53 42.82 0.00 0.00 1.9602 0.0000 365172.01 365172.01 0.00% 12204.17 12204.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.82 32 58 8527.12 5861 11548 8527.89 8320 8705 365172 365172 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.64
  • if_expr:cast_time<havoc_remains
    Internal Combustion 506 5.2% 42.5 13.35sec 3531 0 Direct 42.5 2965 5927 3532 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.47 42.47 0.00 0.00 0.0000 0.0000 149978.36 149978.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 34.35 22 50 2965.31 52 4607 2968.53 2738 3257 101877 101877 0.00%
crit 19.11% 8.12 1 18 5926.95 421 9209 5923.93 3452 7562 48101 48101 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 810 8.4% 36.7 7.93sec 6562 5248 Direct 56.2 3579 7201 4280 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.67 56.22 0.00 0.00 1.2502 0.0000 240621.25 240621.25 0.00% 5248.35 5248.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 45.33 30 58 3579.05 2047 5042 3579.58 3356 3831 162283 162283 0.00%
crit 19.37% 10.89 2 23 7200.61 4095 10084 7204.00 4225 9384 78339 78339 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.12
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.55
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1697 17.5% 26.5 10.89sec 19039 15096 Direct 33.6 1527 3048 1814 18.8%
Periodic 344.6 1079 2159 1288 19.3% 95.9%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.51 33.65 344.63 344.63 1.2612 2.4829 504712.28 504712.28 0.00% 567.65 15095.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.21% 27.32 18 40 1526.80 820 2017 1526.91 1393 1680 41717 41717 0.00%
crit 18.79% 6.32 0 15 3048.02 1639 4033 3041.68 0 3856 19268 19268 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 278.03 212 353 1078.87 0 1714 1079.04 1052 1106 299970 299970 0.00%
crit 19.33% 66.61 35 93 2158.57 9 3428 2158.56 1999 2339 143758 143758 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.88
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.73
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 579 6.0% 44.3 6.12sec 3895 2661 Direct 54.7 (54.7) 2639 5288 3153 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.27 54.70 0.00 0.00 1.4636 0.0000 172431.80 172431.80 0.00% 2661.15 2661.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 44.10 21 66 2639.50 1312 3232 2642.43 2454 2847 116392 116392 0.00%
crit 19.37% 10.60 2 21 5287.96 2624 6464 5296.36 3917 6192 56040 56040 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.77
    havoc
    [R]:10.78
  • if_expr:cast_time<havoc_remains
Rain of Fire 913 9.4% 17.4 16.31sec 15638 12539 Periodic 411.7 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.35 0.00 0.00 411.68 1.2472 0.0000 271354.64 271354.64 0.00% 12538.91 12538.91
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 332.52 229 461 552.77 507 599 552.77 545 560 183813 183813 0.00%
crit 19.23% 79.17 46 120 1105.85 1013 1198 1105.73 1080 1124 87542 87542 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.32
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.04
Soul Fire 514 5.3% 5.5 49.40sec 27656 7953 Direct 7.8 16368 32354 19469 19.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.83 0.00 0.00 3.4775 0.0000 152691.89 152691.89 0.00% 7953.12 7953.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 6.30 2 11 16367.80 8630 21176 16425.32 13746 19860 103141 103141 0.00%
crit 19.57% 1.53 0 5 32353.83 17267 42353 26400.62 0 42300 49551 49551 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.24
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.38
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.5% 5.2 62.48sec 19346 15489 Periodic 96.0 883 1765 1053 19.3% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.23 0.00 96.00 96.00 1.2491 1.2897 101113.16 101113.16 0.00% 775.79 15489.15
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.72% 77.49 52 99 882.99 424 1395 882.99 831 938 68407 68407 0.00%
crit 19.28% 18.51 5 32 1765.20 849 2790 1768.40 1320 2177 32706 32706 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.24
Summon Infernal 82 0.8% 2.0 180.54sec 12022 10400 Direct 6.0 3348 6696 4007 19.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24043.73 24043.73 0.00% 10399.54 10399.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.31% 4.82 1 6 3348.13 3348 3348 3348.13 3348 3348 16134 16134 0.00%
crit 19.69% 1.18 0 5 6696.27 6696 6696 4962.61 0 6696 7910 7910 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3506 / 716
Immolation 3240 6.7% 39.0 5.49sec 4985 0 Direct 117.0 1395 2790 1662 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194434.27 194434.27 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 94.63 82 106 1395.06 1395 1395 1395.06 1395 1395 132009 132009 0.00%
crit 19.12% 22.37 11 35 2790.11 2790 2790 2790.11 2790 2790 62425 62425 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15918.34 22737.76 29.99% 270.24 270.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 33.10 25 40 325.55 326 326 325.55 326 326 10777 15394 29.99%
crit 19.26% 7.90 1 16 651.10 651 651 651.10 651 651 5141 7344 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.3% 92.6 3.21sec 1654 1136 Direct 91.9 1395 2790 1668 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 153162.73 153162.73 0.00% 1136.30 1136.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 73.96 53 96 1395.06 1395 1395 1395.06 1395 1395 103175 103175 0.00%
crit 19.50% 17.92 6 35 2790.11 2790 2790 2790.11 2790 2790 49987 49987 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
NF_CombustingEngine
Havoc 9.6 31.91sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.59
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 7.9sec 7.9sec 4.1sec 50.46% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.1s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.46%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.2 0.0 62.4sec 62.4sec 7.9sec 13.90% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.2s
  • trigger_min/max:61.3s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.90%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NF_CombustingEngine_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NF_CombustingEngine_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.22% 11.35% 17.47% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NF_CombustingEngine
soul_fire Soul Shard 6.53 7.18 7.60% 1.10 0.72 9.12%
immolate Soul Shard 344.70 33.33 35.28% 0.10 1.14 3.31%
incinerate Soul Shard 44.30 11.00 11.64% 0.25 0.00 0.03%
conflagrate Soul Shard 36.67 28.11 29.76% 0.77 0.00 0.00%
mana_regen Mana 654.30 114939.34 100.00% 175.67 33582.66 22.61%
immolate_crits Soul Shard 33.42 3.24 3.43% 0.10 0.11 3.16%
incinerate_crits Soul Shard 10.61 1.06 1.12% 0.10 0.00 0.04%
infernal Soul Shard 120.00 10.55 11.17% 0.09 1.45 12.05%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.11 388.72 33596.9 49221.8 47687.5 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NF_CombustingEngine
cataclysm Mana 9.6 4817.0 500.0 500.5 47.9
channel_demonfire Mana 11.9 8950.3 750.0 749.5 34.0
chaos_bolt Soul Shard 21.5 43.0 2.0 2.0 11970.6
conflagrate Mana 36.7 18336.0 500.0 500.0 13.1
havoc Mana 9.6 9588.3 1000.0 1000.6 0.0
immolate Mana 26.5 19883.3 750.0 750.0 25.4
incinerate Mana 44.3 44301.3 1000.0 1000.6 3.9
rain_of_fire Soul Shard 17.4 52.1 3.0 3.0 5209.0
soul_fire Mana 6.5 6533.1 1000.0 1183.3 23.4
soul_rot Mana 5.2 1305.2 250.0 249.7 77.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NF_CombustingEngine Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
NF_CombustingEngine Damage Per Second
Count 618
Mean 9702.72
Minimum 9123.37
Maximum 10485.57
Spread ( max - min ) 1362.20
Range [ ( max - min ) / 2 * 100% ] 7.02%
Standard Deviation 222.5336
5th Percentile 9353.37
95th Percentile 10074.59
( 95th Percentile - 5th Percentile ) 721.22
Mean Distribution
Standard Deviation 8.9516
95.00% Confidence Interval ( 9685.18 - 9720.27 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2021
0.1 Scale Factor Error with Delta=300 423
0.05 Scale Factor Error with Delta=300 1691
0.01 Scale Factor Error with Delta=300 42275
Priority Target DPS
NF_CombustingEngine Priority Target Damage Per Second
Count 618
Mean 5204.74
Minimum 4863.57
Maximum 5653.85
Spread ( max - min ) 790.27
Range [ ( max - min ) / 2 * 100% ] 7.59%
Standard Deviation 128.1659
5th Percentile 4999.03
95th Percentile 5430.45
( 95th Percentile - 5th Percentile ) 431.42
Mean Distribution
Standard Deviation 5.1556
95.00% Confidence Interval ( 5194.63 - 5214.84 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2330
0.1 Scale Factor Error with Delta=300 141
0.05 Scale Factor Error with Delta=300 561
0.01 Scale Factor Error with Delta=300 14023
DPS(e)
NF_CombustingEngine Damage Per Second (Effective)
Count 618
Mean 9702.72
Minimum 9123.37
Maximum 10485.57
Spread ( max - min ) 1362.20
Range [ ( max - min ) / 2 * 100% ] 7.02%
Damage
NF_CombustingEngine Damage
Count 618
Mean 2517563.56
Minimum 2030371.63
Maximum 3034500.69
Spread ( max - min ) 1004129.06
Range [ ( max - min ) / 2 * 100% ] 19.94%
DTPS
NF_CombustingEngine Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NF_CombustingEngine Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NF_CombustingEngine Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NF_CombustingEngine Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NF_CombustingEngine Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NF_CombustingEngine Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NF_CombustingEngineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NF_CombustingEngine Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.24 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.32 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.24 soul_rot
F 11.93 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.88 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.59 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.04 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.12 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.77 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.55 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.38 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.73 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.64 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.78 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFIRNQRNPQ9GKJFLKAELLINQQPRNFGJGLKLLLJAK9FIQNQRNPRGJLKLFEAKJLLIRNQRQP9FGKJLKALLKIQRQPRNFGLGMDKELKAD9IQNQQNPDFGLKLJLLAKLIQRNPQRFK9GEGJKLAJIRNQRNPRFJLGKLLLJKLAIRNOQRFJKLLGEJG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.990 cds M summon_infernal Fluffy_Pillow 49995.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.998 aoe I havoc enemy2 49499.0/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.005 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.013 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.020 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.426 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.433 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.440 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:14.846 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:15.852 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.260 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:18.267 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.273 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.699 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:22.706 aoe G immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.713 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.719 aoe G immolate enemy3 49509.0/50000: 99% mana
0.3/5: 6% soul_shard
bloodlust, backdraft
0:25.726 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:26.666 aoe K conflagrate Fluffy_Pillow 48722.5/50000: 97% mana
1.1/5: 22% soul_shard
bloodlust
0:27.671 aoe L incinerate Fluffy_Pillow 48725.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.611 aoe L incinerate Fluffy_Pillow 48195.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:29.952 aoe D rain_of_fire Fluffy_Pillow 47865.5/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust
0:30.957 aoe K conflagrate Fluffy_Pillow 48368.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:31.965 default A cataclysm Fluffy_Pillow 48372.0/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:33.306 aoe L incinerate Fluffy_Pillow 48542.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:34.246 aoe L incinerate Fluffy_Pillow 48012.5/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:35.588 aoe J rain_of_fire Fluffy_Pillow 47683.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.595 aoe F channel_demonfire Fluffy_Pillow 48187.0/50000: 96% mana
0.4/5: 8% soul_shard
bloodlust
0:38.918 aoe I havoc enemy2 48598.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:39.925 havoc R incinerate Fluffy_Pillow 48102.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:41.267 havoc N conflagrate Fluffy_Pillow 47773.0/50000: 96% mana
1.4/5: 28% soul_shard
0:42.574 havoc Q chaos_bolt Fluffy_Pillow 47926.5/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
0:44.400 havoc R incinerate Fluffy_Pillow 48839.5/50000: 98% mana
1.0/5: 20% soul_shard
0:46.140 havoc N conflagrate Fluffy_Pillow 48709.5/50000: 97% mana
1.4/5: 28% soul_shard
0:47.447 havoc P immolate Fluffy_Pillow 48863.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
0:48.753 havoc Q chaos_bolt Fluffy_Pillow 48766.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
0:50.581 default 9 soul_fire Fluffy_Pillow 49680.0/50000: 99% mana
1.0/5: 20% soul_shard
0:54.060 aoe G immolate enemy3 49003.0/50000: 98% mana
2.5/5: 50% soul_shard
0:55.367 aoe K conflagrate Fluffy_Pillow 48906.5/50000: 98% mana
2.8/5: 56% soul_shard
0:56.672 aoe J rain_of_fire Fluffy_Pillow 49059.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
0:57.978 aoe F channel_demonfire Fluffy_Pillow 49712.0/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
1:00.772 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:01.991 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:03.298 default A cataclysm Fluffy_Pillow 49155.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
1:05.041 aoe E soul_rot Fluffy_Pillow 49502.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
1:06.347 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
1:07.566 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
soul_rot
1:09.306 aoe I havoc enemy2 48872.0/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
1:10.613 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.2/5: 64% soul_shard
soul_rot
1:11.919 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.3/5: 86% soul_shard
backdraft, soul_rot
1:13.747 havoc Q chaos_bolt Fluffy_Pillow 49592.5/50000: 99% mana
2.6/5: 52% soul_shard
soul_rot
1:16.357 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:17.663 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.9/5: 18% soul_shard
1:19.403 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
1:20.709 aoe F channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:23.510 aoe G immolate enemy3 49805.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:24.816 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:26.122 aoe G immolate enemy2 49905.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:27.429 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
1:28.648 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.3/5: 26% soul_shard
1:29.952 aoe L incinerate Fluffy_Pillow 49014.0/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
1:31.170 aoe L incinerate Fluffy_Pillow 48623.0/50000: 97% mana
2.2/5: 44% soul_shard
1:32.910 aoe L incinerate Fluffy_Pillow 48493.0/50000: 97% mana
2.6/5: 52% soul_shard
1:34.652 aoe J rain_of_fire Fluffy_Pillow 48364.0/50000: 97% mana
3.1/5: 62% soul_shard
1:35.960 default A cataclysm Fluffy_Pillow 49018.0/50000: 98% mana
0.1/5: 2% soul_shard
1:37.700 aoe K conflagrate Fluffy_Pillow 49388.0/50000: 99% mana
0.4/5: 8% soul_shard
1:39.006 default 9 soul_fire Fluffy_Pillow 49541.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
1:42.531 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:45.414 aoe I havoc enemy2 49693.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
1:46.720 havoc Q chaos_bolt Fluffy_Pillow 49346.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:48.547 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:49.854 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
1:51.681 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:53.422 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
1:54.729 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:56.035 havoc R incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:57.255 aoe G immolate enemy3 48669.0/50000: 97% mana
3.0/5: 60% soul_shard
1:58.559 aoe J rain_of_fire Fluffy_Pillow 48571.0/50000: 97% mana
3.2/5: 64% soul_shard
1:59.868 aoe L incinerate Fluffy_Pillow 49225.5/50000: 98% mana
0.4/5: 8% soul_shard
2:01.611 aoe K conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
1.0/5: 20% soul_shard
2:02.917 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
2:04.136 aoe F channel_demonfire Fluffy_Pillow 48766.0/50000: 98% mana
2.1/5: 42% soul_shard
2:07.070 aoe E soul_rot Fluffy_Pillow 49483.0/50000: 99% mana
2.4/5: 48% soul_shard
2:08.377 default A cataclysm Fluffy_Pillow 49752.5/50000: 100% mana
2.5/5: 50% soul_shard
soul_rot
2:10.117 aoe K conflagrate Fluffy_Pillow 49502.0/50000: 99% mana
2.7/5: 54% soul_shard
soul_rot
2:11.426 aoe J rain_of_fire Fluffy_Pillow 49656.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft, soul_rot
2:12.733 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot
2:13.953 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
2:15.693 aoe I havoc enemy2 48872.5/50000: 98% mana
1.3/5: 26% soul_shard
soul_rot
2:16.999 havoc R incinerate Fluffy_Pillow 48525.5/50000: 97% mana
1.5/5: 30% soul_shard
2:18.740 havoc N conflagrate Fluffy_Pillow 48396.0/50000: 97% mana
2.0/5: 40% soul_shard
2:20.048 havoc Q chaos_bolt Fluffy_Pillow 48550.0/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
2:21.876 havoc R incinerate Fluffy_Pillow 49464.0/50000: 99% mana
1.4/5: 28% soul_shard
2:23.615 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
2:26.225 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:27.531 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
2:31.007 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
2:33.958 aoe G immolate enemy3 49727.0/50000: 99% mana
2.5/5: 50% soul_shard
2:35.265 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.6/5: 52% soul_shard
2:36.573 aoe J rain_of_fire Fluffy_Pillow 49406.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:37.879 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
2:39.097 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.7/5: 14% soul_shard
2:40.404 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:42.144 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:43.363 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
2:45.102 aoe K conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
2.3/5: 46% soul_shard
2:46.409 aoe I havoc enemy2 49025.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:47.714 havoc Q chaos_bolt Fluffy_Pillow 48677.5/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
2:49.541 havoc R incinerate Fluffy_Pillow 49591.0/50000: 99% mana
1.4/5: 28% soul_shard
2:51.281 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
2:53.891 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:55.197 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
2:56.938 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
2:58.246 aoe F channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
3:01.042 aoe G immolate enemy3 49804.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
3:02.349 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:03.568 aoe G immolate enemy2 48862.0/50000: 98% mana
3.1/5: 62% soul_shard
3:04.875 cds M summon_infernal Fluffy_Pillow 48765.5/50000: 98% mana
3.3/5: 66% soul_shard
3:06.298 aoe D rain_of_fire Fluffy_Pillow 48477.0/50000: 97% mana
3.7/5: 74% soul_shard
3:07.603 aoe K conflagrate Fluffy_Pillow 49129.5/50000: 98% mana
1.1/5: 22% soul_shard
3:08.911 aoe E soul_rot Fluffy_Pillow 49283.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
3:10.218 aoe L incinerate Fluffy_Pillow 49687.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
3:11.436 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
soul_rot
3:12.743 default A cataclysm Fluffy_Pillow 49155.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft, soul_rot
3:14.482 aoe D rain_of_fire Fluffy_Pillow 49501.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft, soul_rot
3:15.790 default 9 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft, soul_rot
3:19.482 aoe I havoc enemy2 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
3:20.788 havoc Q chaos_bolt Fluffy_Pillow 48655.5/50000: 97% mana
4.6/5: 92% soul_shard
backdraft
3:22.616 havoc N conflagrate Fluffy_Pillow 49569.5/50000: 99% mana
3.0/5: 60% soul_shard
3:23.923 havoc Q chaos_bolt Fluffy_Pillow 49723.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
3:25.750 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.358 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
3:29.665 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
3:30.971 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
3:32.278 aoe F channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:35.152 aoe G immolate enemy3 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:36.459 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
3:37.678 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.2/5: 44% soul_shard
3:38.984 aoe L incinerate Fluffy_Pillow 49015.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:40.203 aoe J rain_of_fire Fluffy_Pillow 48624.5/50000: 97% mana
3.2/5: 64% soul_shard
3:41.509 aoe L incinerate Fluffy_Pillow 49277.5/50000: 99% mana
0.5/5: 10% soul_shard
3:43.250 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
3:44.990 default A cataclysm Fluffy_Pillow 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
3:46.731 aoe K conflagrate Fluffy_Pillow 49243.0/50000: 98% mana
1.6/5: 32% soul_shard
3:48.038 aoe L incinerate Fluffy_Pillow 49396.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:49.257 aoe I havoc enemy2 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
3:50.789 havoc Q chaos_bolt Fluffy_Pillow 48768.0/50000: 98% mana
2.6/5: 52% soul_shard
3:53.400 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
3:55.139 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.6/5: 32% soul_shard
3:56.444 havoc P immolate Fluffy_Pillow 49154.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:57.751 havoc Q chaos_bolt Fluffy_Pillow 49057.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:59.578 havoc R incinerate Fluffy_Pillow 49971.0/50000: 100% mana
1.2/5: 24% soul_shard
4:01.319 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
1.9/5: 38% soul_shard
4:04.082 aoe K conflagrate Fluffy_Pillow 49634.0/50000: 99% mana
2.3/5: 46% soul_shard
4:05.389 default 9 soul_fire Fluffy_Pillow 49787.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
4:08.866 aoe G immolate enemy3 49002.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
4:10.173 aoe E soul_rot Fluffy_Pillow 48905.5/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
4:11.520 aoe G immolate enemy2 49329.0/50000: 99% mana
4.7/5: 94% soul_shard
backdraft, soul_rot
4:12.825 aoe J rain_of_fire Fluffy_Pillow 49231.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
4:14.131 aoe K conflagrate Fluffy_Pillow 49884.5/50000: 100% mana
2.0/5: 40% soul_shard
soul_rot
4:15.439 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft, soul_rot
4:16.660 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
3.0/5: 60% soul_shard
soul_rot
4:18.465 aoe J rain_of_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.3/5: 66% soul_shard
soul_rot
4:19.772 aoe I havoc enemy2 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:21.079 havoc R incinerate Fluffy_Pillow 49653.5/50000: 99% mana
0.7/5: 14% soul_shard
4:22.820 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:24.128 havoc Q chaos_bolt Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
4:25.955 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:27.694 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
4:28.999 havoc P immolate Fluffy_Pillow 49154.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:30.305 havoc R incinerate Fluffy_Pillow 49057.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:31.525 aoe F channel_demonfire Fluffy_Pillow 48667.0/50000: 97% mana
3.2/5: 64% soul_shard
4:34.481 aoe J rain_of_fire Fluffy_Pillow 49395.0/50000: 99% mana
3.6/5: 72% soul_shard
4:35.788 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:37.530 aoe G immolate enemy3 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
4:38.839 aoe K conflagrate Fluffy_Pillow 48907.5/50000: 98% mana
1.4/5: 28% soul_shard
4:40.145 aoe L incinerate Fluffy_Pillow 49060.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:41.364 aoe L incinerate Fluffy_Pillow 48670.0/50000: 97% mana
2.3/5: 46% soul_shard
4:43.105 aoe L incinerate Fluffy_Pillow 48540.5/50000: 97% mana
2.6/5: 52% soul_shard
4:44.845 aoe J rain_of_fire Fluffy_Pillow 48410.5/50000: 97% mana
3.1/5: 62% soul_shard
4:46.153 aoe K conflagrate Fluffy_Pillow 49064.5/50000: 98% mana
0.1/5: 2% soul_shard
4:47.458 aoe L incinerate Fluffy_Pillow 49217.0/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
4:48.678 default A cataclysm Fluffy_Pillow 48827.0/50000: 98% mana
1.1/5: 22% soul_shard
4:50.420 aoe I havoc enemy2 49198.0/50000: 98% mana
1.4/5: 28% soul_shard
4:51.725 havoc R incinerate Fluffy_Pillow 48850.5/50000: 98% mana
1.6/5: 32% soul_shard
4:53.465 havoc N conflagrate Fluffy_Pillow 48720.5/50000: 97% mana
2.1/5: 42% soul_shard
4:54.790 havoc O soul_fire Fluffy_Pillow 48883.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
4:58.268 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:00.096 havoc R incinerate Fluffy_Pillow 49916.5/50000: 100% mana
3.0/5: 60% soul_shard
5:01.836 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
3.4/5: 68% soul_shard
5:04.541 aoe J rain_of_fire Fluffy_Pillow 49604.5/50000: 99% mana
3.8/5: 76% soul_shard
5:05.847 aoe K conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
5:07.151 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
5:08.371 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
5:10.113 aoe G immolate enemy3 48873.5/50000: 98% mana
2.8/5: 56% soul_shard
5:11.419 aoe E soul_rot Fluffy_Pillow 48776.5/50000: 98% mana
2.8/5: 56% soul_shard
5:12.822 aoe J rain_of_fire Fluffy_Pillow 49228.0/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
5:14.128 aoe G immolate Fluffy_Pillow 49881.0/50000: 100% mana
0.3/5: 6% soul_shard
soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NF_CombustingEngine"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=212:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NF_DuplicitousHavoc : 9749 dps, 5109 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9749.4 9749.4 17.0 / 0.175% 797.9 / 8.2% 21.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.6 386.0 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NF_DuplicitousHavoc 9749
Cataclysm 776 8.0% 9.6 32.36sec 24025 14142 Direct 28.8 6699 13406 8009 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.61 28.83 0.00 0.00 1.6989 0.0000 230843.05 230843.05 0.00% 14142.20 14142.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 23.20 13 33 6699.42 6142 7261 6699.68 6470 6899 155422 155422 0.00%
crit 19.52% 5.63 0 14 13406.36 12283 14521 13347.45 0 14421 75421 75421 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.67
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1024) 0.0% (10.5%) 12.0 25.66sec 25439 9450

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.96 0.00 178.79 0.00 2.6921 0.1633 0.00 0.00 0.00% 9449.67 9449.67

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.95
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1024 10.5% 0.0 0.00sec 0 0 Direct 536.4 476 952 567 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.36 0.00 0.00 0.0000 0.0000 304326.78 304326.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 433.05 316 584 475.75 263 976 475.96 444 503 205992 205992 0.00%
crit 19.26% 103.31 61 153 951.78 525 1952 952.54 798 1100 98335 98335 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1347 (1795) 13.8% (18.4%) 21.6 13.40sec 24720 12604 Direct 42.9 (85.4) 0 9319 9319 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.56 42.91 0.00 0.00 1.9613 0.0000 399923.87 399923.87 0.00% 12603.97 12603.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.91 32 60 9319.28 7326 11548 9319.55 9138 9548 399924 399924 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.65
  • if_expr:cast_time<havoc_remains
    Internal Combustion 448 4.6% 42.5 13.35sec 3126 0 Direct 42.5 2625 5259 3128 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 0.0000 0.0000 132946.85 132946.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 34.42 23 52 2625.40 1 3715 2627.68 2430 2833 90362 90362 0.00%
crit 19.07% 8.11 2 17 5259.36 286 7430 5265.96 3835 6556 42585 42585 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 858 8.8% 36.7 7.95sec 6954 5562 Direct 56.2 3802 7609 4536 19.3%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.66 56.20 0.00 0.00 1.2503 0.0000 254939.45 254939.45 0.00% 5561.51 5561.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 45.37 29 61 3802.45 2559 5042 3802.59 3591 4006 172546 172546 0.00%
crit 19.27% 10.83 1 22 7609.31 5118 10084 7611.08 6413 9107 82393 82393 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.11
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.56
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1618 16.6% 26.5 10.71sec 18126 14371 Direct 33.7 1585 3176 1895 19.6%
Periodic 344.4 1014 2030 1212 19.4% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.55 33.72 344.37 344.37 1.2613 2.4836 481186.67 481186.67 0.00% 541.41 14371.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 27.13 16 44 1584.55 1024 2017 1584.87 1495 1673 42987 42987 0.00%
crit 19.55% 6.59 1 15 3176.15 2055 4034 3179.27 2639 3844 20944 20944 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 277.41 218 352 1014.27 0 1261 1014.28 995 1037 281363 281363 0.00%
crit 19.44% 66.95 41 97 2029.74 3 2521 2029.71 1906 2128 135892 135892 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.86
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.80
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 594 6.1% 44.2 6.17sec 4002 2735 Direct 54.5 (54.5) 2719 5456 3245 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.21 54.54 0.00 0.00 1.4635 0.0000 176930.93 176930.93 0.00% 2734.59 2734.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 44.08 27 67 2719.20 1641 3232 2720.42 2558 2873 119866 119866 0.00%
crit 19.17% 10.46 2 23 5456.18 3281 6464 5456.96 4628 6083 57065 57065 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.77
    havoc
    [R]:10.73
  • if_expr:cast_time<havoc_remains
Rain of Fire 912 9.4% 17.3 16.36sec 15671 12571 Periodic 410.3 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.29 0.00 0.00 410.33 1.2467 0.0000 270954.53 270954.53 0.00% 12570.96 12570.96
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 330.56 219 450 552.91 507 599 552.91 545 563 182763 182763 0.00%
crit 19.44% 79.78 43 123 1105.60 1013 1198 1105.48 1079 1146 88192 88192 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.29
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:12.01
Soul Fire 521 5.4% 5.5 49.41sec 28027 8060 Direct 7.8 16830 33710 19984 18.6%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.75 0.00 0.00 3.4775 0.0000 154922.08 154922.08 0.00% 8059.62 8059.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.36% 6.31 1 10 16830.16 10774 21175 16860.49 14455 20070 106220 106220 0.00%
crit 18.64% 1.44 0 5 33709.56 21509 42330 26244.50 0 42276 48702 48702 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.32
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.31
  • if_expr:cast_time<havoc_remains
Soul Rot 340 3.5% 5.2 62.37sec 19333 15479 Periodic 95.9 884 1759 1053 19.4% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 95.92 95.92 1.2491 1.2895 101013.83 101013.83 0.00% 775.79 15478.67
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 77.35 45 101 883.81 424 1395 883.84 824 928 68363 68363 0.00%
crit 19.35% 18.56 6 33 1758.51 849 2790 1760.00 1378 2476 32650 32650 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.24
Summon Infernal 81 0.8% 2.0 180.96sec 11895 10289 Direct 6.0 3348 6696 3969 18.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23789.10 23789.10 0.00% 10289.40 10289.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.58% 4.89 2 6 3348.13 3348 3348 3348.13 3348 3348 16389 16389 0.00%
crit 18.42% 1.11 0 4 6696.27 6696 6696 4843.42 0 6696 7401 7401 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3511 / 717
Immolation 3246 6.7% 39.0 5.50sec 4994 0 Direct 117.0 1395 2790 1665 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194766.11 194766.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 94.39 79 105 1395.06 1395 1395 1395.06 1395 1395 131677 131677 0.00%
crit 19.33% 22.61 12 38 2790.11 2790 2790 2790.11 2790 2790 63089 63089 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.5% 41.0 5.26sec 387 270 Direct 41.0 326 651 387 19.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15877.78 22679.82 29.99% 269.55 269.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 33.23 24 39 325.55 326 326 325.55 326 326 10817 15452 29.99%
crit 18.96% 7.77 2 17 651.10 651 651 651.10 651 651 5060 7228 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 92.6 3.21sec 1650 1134 Direct 91.9 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152833.15 152833.15 0.00% 1133.85 1133.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 74.19 54 98 1395.06 1395 1395 1395.06 1395 1395 103505 103505 0.00%
crit 19.24% 17.68 5 34 2790.11 2790 2790 2790.11 2790 2790 49328 49328 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
NF_DuplicitousHavoc
Havoc 9.6 31.98sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.57
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.1sec 50.38% 0.00% 0.0 (0.0) 1.5

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.4s
  • trigger_min/max:2.1s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.38%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.2 0.0 62.4sec 62.4sec 7.9sec 13.89% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.7s
  • trigger_min/max:61.3s / 68.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • soul_rot_1:13.89%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NF_DuplicitousHavoc_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NF_DuplicitousHavoc_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.4s
  • trigger_min/max:180.0s / 187.4s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.19% 10.78% 17.76% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NF_DuplicitousHavoc
soul_fire Soul Shard 6.54 7.13 7.56% 1.09 0.70 8.89%
immolate Soul Shard 344.43 33.29 35.28% 0.10 1.16 3.36%
incinerate Soul Shard 44.26 10.98 11.64% 0.25 0.01 0.05%
conflagrate Soul Shard 36.66 28.11 29.79% 0.77 0.00 0.00%
mana_regen Mana 654.17 114911.70 100.00% 175.66 33606.50 22.63%
immolate_crits Soul Shard 33.49 3.24 3.43% 0.10 0.11 3.36%
incinerate_crits Soul Shard 10.50 1.05 1.11% 0.10 0.00 0.06%
infernal Soul Shard 120.00 10.56 11.19% 0.09 1.44 11.98%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.00 388.58 33627.2 49230.1 47890.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.1 5.0
Usage Type Count Total Avg RPE APR
NF_DuplicitousHavoc
cataclysm Mana 9.6 4809.1 500.0 500.5 48.0
channel_demonfire Mana 12.0 8964.5 750.0 749.4 33.9
chaos_bolt Soul Shard 21.5 43.1 2.0 2.0 12371.5
conflagrate Mana 36.7 18332.0 500.0 500.0 13.9
havoc Mana 9.6 9574.1 1000.0 1000.6 0.0
immolate Mana 26.5 19899.8 750.0 749.6 24.2
incinerate Mana 44.3 44260.3 1000.0 1001.2 4.0
rain_of_fire Soul Shard 17.3 51.9 3.0 3.0 5219.4
soul_fire Mana 6.5 6537.9 1000.0 1182.8 23.7
soul_rot Mana 5.2 1304.8 250.0 249.7 77.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NF_DuplicitousHavoc Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
NF_DuplicitousHavoc Damage Per Second
Count 618
Mean 9749.39
Minimum 9250.57
Maximum 10348.94
Spread ( max - min ) 1098.37
Range [ ( max - min ) / 2 * 100% ] 5.63%
Standard Deviation 216.0265
5th Percentile 9434.88
95th Percentile 10122.56
( 95th Percentile - 5th Percentile ) 687.67
Mean Distribution
Standard Deviation 8.6899
95.00% Confidence Interval ( 9732.35 - 9766.42 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1887
0.1 Scale Factor Error with Delta=300 399
0.05 Scale Factor Error with Delta=300 1594
0.01 Scale Factor Error with Delta=300 39839
Priority Target DPS
NF_DuplicitousHavoc Priority Target Damage Per Second
Count 618
Mean 5109.02
Minimum 4828.32
Maximum 5611.44
Spread ( max - min ) 783.12
Range [ ( max - min ) / 2 * 100% ] 7.66%
Standard Deviation 123.0551
5th Percentile 4919.73
95th Percentile 5321.63
( 95th Percentile - 5th Percentile ) 401.90
Mean Distribution
Standard Deviation 4.9500
95.00% Confidence Interval ( 5099.32 - 5118.72 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2229
0.1 Scale Factor Error with Delta=300 130
0.05 Scale Factor Error with Delta=300 518
0.01 Scale Factor Error with Delta=300 12927
DPS(e)
NF_DuplicitousHavoc Damage Per Second (Effective)
Count 618
Mean 9749.39
Minimum 9250.57
Maximum 10348.94
Spread ( max - min ) 1098.37
Range [ ( max - min ) / 2 * 100% ] 5.63%
Damage
NF_DuplicitousHavoc Damage
Count 618
Mean 2531777.12
Minimum 2058064.16
Maximum 3096116.96
Spread ( max - min ) 1038052.80
Range [ ( max - min ) / 2 * 100% ] 20.50%
DTPS
NF_DuplicitousHavoc Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NF_DuplicitousHavoc Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NF_DuplicitousHavoc Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NF_DuplicitousHavoc Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NF_DuplicitousHavoc Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NF_DuplicitousHavoc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NF_DuplicitousHavocTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NF_DuplicitousHavoc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.32 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.67 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.29 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.24 soul_rot
F 11.95 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.86 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.57 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 12.01 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.11 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.77 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.56 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.31 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.80 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.65 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.73 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLJFIRNQRNOGGJLKFJLEAKLKIQRRPNQFLGJKLLLLA9IQNQNQPNFGJLKLLELAJIRNQRNPRFJ9GKJLKLLAIQNQRRNPFGJGLKLMELDKAIOQNQRDFGGDGKLKLJLLAINQRNQRPFGK9EGJLKJLAINQRRRNPFGJLGKLLJKLLAIQNOPQNFJLEGKJG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E soul_rot Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.745 aoe F channel_demonfire Fluffy_Pillow 49622.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.947 cds M summon_infernal Fluffy_Pillow 49973.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:05.953 aoe I havoc enemy2 49476.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:06.959 havoc Q chaos_bolt Fluffy_Pillow 48979.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.966 havoc N conflagrate Fluffy_Pillow 49983.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.974 havoc Q chaos_bolt Fluffy_Pillow 49987.0/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.381 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.387 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:13.394 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:14.801 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:15.808 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:17.213 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:18.219 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:19.226 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:21.707 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:22.715 aoe G immolate enemy2 49253.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:23.722 aoe G immolate enemy3 49006.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:24.727 aoe D rain_of_fire Fluffy_Pillow 48759.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:25.734 aoe L incinerate Fluffy_Pillow 49262.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.672 aoe K conflagrate Fluffy_Pillow 48731.5/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust
0:27.681 aoe L incinerate Fluffy_Pillow 48736.0/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.621 aoe L incinerate Fluffy_Pillow 48206.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:29.962 aoe D rain_of_fire Fluffy_Pillow 47876.5/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust
0:30.970 aoe K conflagrate Fluffy_Pillow 48380.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:31.977 default A cataclysm Fluffy_Pillow 48384.0/50000: 97% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:33.317 aoe L incinerate Fluffy_Pillow 48554.0/50000: 97% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:34.258 aoe L incinerate Fluffy_Pillow 48024.5/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:35.598 aoe J rain_of_fire Fluffy_Pillow 47694.5/50000: 95% mana
3.1/5: 62% soul_shard
bloodlust
0:36.605 aoe F channel_demonfire Fluffy_Pillow 48198.0/50000: 96% mana
0.3/5: 6% soul_shard
bloodlust
0:38.802 aoe I havoc enemy2 48546.5/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:39.808 havoc R incinerate Fluffy_Pillow 48049.5/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust
0:41.148 havoc N conflagrate Fluffy_Pillow 47719.5/50000: 95% mana
1.4/5: 28% soul_shard
0:42.455 havoc Q chaos_bolt Fluffy_Pillow 47873.0/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
0:44.282 havoc R incinerate Fluffy_Pillow 48786.5/50000: 98% mana
0.8/5: 16% soul_shard
0:46.023 havoc N conflagrate Fluffy_Pillow 48657.0/50000: 97% mana
1.5/5: 30% soul_shard
0:47.328 havoc O soul_fire Fluffy_Pillow 48809.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
0:50.807 aoe G immolate Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.112 aoe G immolate enemy3 48905.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:53.419 aoe J rain_of_fire Fluffy_Pillow 48809.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:54.726 aoe L incinerate Fluffy_Pillow 49462.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:55.945 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:57.252 aoe F channel_demonfire Fluffy_Pillow 49155.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:00.053 aoe J rain_of_fire Fluffy_Pillow 49806.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:01.359 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:02.578 aoe E soul_rot Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
1:04.048 default A cataclysm Fluffy_Pillow 49487.0/50000: 99% mana
1.1/5: 22% soul_shard
soul_rot
1:05.788 aoe K conflagrate Fluffy_Pillow 49502.0/50000: 99% mana
1.3/5: 26% soul_shard
soul_rot
1:07.095 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, soul_rot
1:08.316 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
soul_rot
1:09.854 aoe I havoc enemy2 49272.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
1:11.161 havoc Q chaos_bolt Fluffy_Pillow 48925.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft, soul_rot
1:12.988 havoc R incinerate Fluffy_Pillow 49839.0/50000: 100% mana
1.3/5: 26% soul_shard
1:14.728 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
1:16.469 havoc P immolate Fluffy_Pillow 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
1:17.776 havoc N conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
2.7/5: 54% soul_shard
1:19.082 havoc Q chaos_bolt Fluffy_Pillow 48929.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:20.909 aoe F channel_demonfire Fluffy_Pillow 49842.5/50000: 100% mana
2.2/5: 44% soul_shard
1:23.834 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:25.573 aoe G immolate enemy3 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
1:26.881 aoe J rain_of_fire Fluffy_Pillow 48905.5/50000: 98% mana
3.2/5: 64% soul_shard
1:28.187 aoe K conflagrate Fluffy_Pillow 49558.5/50000: 99% mana
0.3/5: 6% soul_shard
1:29.493 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
1:30.709 aoe L incinerate Fluffy_Pillow 49000.5/50000: 98% mana
1.3/5: 26% soul_shard
1:32.450 aoe L incinerate Fluffy_Pillow 48871.0/50000: 98% mana
1.9/5: 38% soul_shard
1:34.190 aoe L incinerate Fluffy_Pillow 48741.0/50000: 97% mana
2.4/5: 48% soul_shard
1:35.930 default A cataclysm Fluffy_Pillow 48611.0/50000: 97% mana
2.7/5: 54% soul_shard
1:37.671 default 9 soul_fire Fluffy_Pillow 48981.5/50000: 98% mana
3.0/5: 60% soul_shard
1:41.149 aoe I havoc enemy2 49002.5/50000: 98% mana
4.4/5: 88% soul_shard
1:42.454 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
4.4/5: 88% soul_shard
1:45.064 havoc N conflagrate Fluffy_Pillow 49960.0/50000: 100% mana
2.8/5: 56% soul_shard
1:46.370 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
backdraft
1:48.198 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
1:49.504 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:51.333 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
1:52.639 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.7/5: 34% soul_shard
1:53.943 aoe F channel_demonfire Fluffy_Pillow 49404.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:56.790 aoe G immolate enemy3 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:58.097 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:59.403 aoe L incinerate Fluffy_Pillow 49905.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
2:00.623 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:01.928 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:03.149 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
2:04.891 aoe E soul_rot Fluffy_Pillow 48636.5/50000: 97% mana
2.6/5: 52% soul_shard
2:06.198 aoe L incinerate Fluffy_Pillow 49040.0/50000: 98% mana
2.7/5: 54% soul_shard
soul_rot
2:07.938 default A cataclysm Fluffy_Pillow 48910.0/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot
2:09.679 aoe J rain_of_fire Fluffy_Pillow 49280.5/50000: 99% mana
3.6/5: 72% soul_shard
soul_rot
2:10.988 aoe I havoc enemy2 49935.0/50000: 100% mana
0.6/5: 12% soul_shard
soul_rot
2:12.454 havoc R incinerate Fluffy_Pillow 49652.5/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot
2:14.194 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:15.501 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:17.328 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
2:19.069 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
2:20.377 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:21.683 havoc R incinerate Fluffy_Pillow 49059.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:22.902 aoe F channel_demonfire Fluffy_Pillow 48669.0/50000: 97% mana
3.6/5: 72% soul_shard
2:25.745 aoe J rain_of_fire Fluffy_Pillow 49340.5/50000: 99% mana
4.0/5: 80% soul_shard
2:27.051 default 9 soul_fire Fluffy_Pillow 49993.5/50000: 100% mana
1.1/5: 22% soul_shard
2:30.527 aoe G immolate enemy3 49001.5/50000: 98% mana
2.7/5: 54% soul_shard
2:31.832 aoe K conflagrate Fluffy_Pillow 48904.0/50000: 98% mana
2.7/5: 54% soul_shard
2:33.140 aoe J rain_of_fire Fluffy_Pillow 49058.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
2:34.447 aoe L incinerate Fluffy_Pillow 49711.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
2:35.665 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
2:36.973 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:38.194 aoe L incinerate Fluffy_Pillow 48766.0/50000: 98% mana
1.8/5: 36% soul_shard
2:39.937 default A cataclysm Fluffy_Pillow 48637.5/50000: 97% mana
2.2/5: 44% soul_shard
2:41.677 aoe I havoc enemy2 49007.5/50000: 98% mana
2.6/5: 52% soul_shard
2:42.983 havoc Q chaos_bolt Fluffy_Pillow 48660.5/50000: 97% mana
2.8/5: 56% soul_shard
2:45.592 havoc N conflagrate Fluffy_Pillow 49965.0/50000: 100% mana
1.1/5: 22% soul_shard
2:46.899 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
2:48.726 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:50.466 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
2:52.206 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
1.7/5: 34% soul_shard
2:53.643 havoc P immolate Fluffy_Pillow 49090.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:54.950 aoe F channel_demonfire Fluffy_Pillow 48994.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:57.935 aoe G immolate enemy2 49736.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
2:59.241 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
3:00.548 aoe G immolate enemy3 49905.5/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
3:01.855 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
3:03.074 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
0.9/5: 18% soul_shard
3:04.380 aoe L incinerate Fluffy_Pillow 49015.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
3:05.600 cds M summon_infernal Fluffy_Pillow 48625.0/50000: 97% mana
1.9/5: 38% soul_shard
3:06.907 aoe E soul_rot Fluffy_Pillow 48278.5/50000: 97% mana
2.2/5: 44% soul_shard
3:08.213 aoe L incinerate Fluffy_Pillow 48681.5/50000: 97% mana
2.8/5: 56% soul_shard
soul_rot
3:09.953 aoe D rain_of_fire Fluffy_Pillow 48551.5/50000: 97% mana
3.6/5: 72% soul_shard
soul_rot
3:11.258 aoe K conflagrate Fluffy_Pillow 49204.0/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot
3:12.566 default A cataclysm Fluffy_Pillow 49358.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft, soul_rot
3:14.304 aoe I havoc enemy2 49501.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft, soul_rot
3:15.610 havoc O soul_fire Fluffy_Pillow 49154.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
3:19.088 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:20.914 havoc N conflagrate Fluffy_Pillow 49915.5/50000: 100% mana
3.0/5: 60% soul_shard
3:22.221 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:24.049 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.789 aoe D rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
4.1/5: 82% soul_shard
3:27.095 aoe F channel_demonfire Fluffy_Pillow 49655.0/50000: 99% mana
1.4/5: 28% soul_shard
3:29.938 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
3:31.245 aoe G immolate enemy2 49252.5/50000: 99% mana
2.9/5: 58% soul_shard
3:32.552 aoe D rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.3/5: 66% soul_shard
3:33.857 aoe G immolate enemy3 49808.5/50000: 100% mana
0.7/5: 14% soul_shard
3:35.164 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
3:36.471 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
3:37.690 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
3:38.994 aoe L incinerate Fluffy_Pillow 49154.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
3:40.211 aoe J rain_of_fire Fluffy_Pillow 48762.5/50000: 98% mana
3.3/5: 66% soul_shard
3:41.517 aoe L incinerate Fluffy_Pillow 49415.5/50000: 99% mana
0.5/5: 10% soul_shard
3:43.259 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
3:44.999 default A cataclysm Fluffy_Pillow 48873.0/50000: 98% mana
1.3/5: 26% soul_shard
3:46.739 aoe I havoc enemy2 49243.0/50000: 98% mana
1.6/5: 32% soul_shard
3:48.046 havoc N conflagrate Fluffy_Pillow 48896.5/50000: 98% mana
1.7/5: 34% soul_shard
3:49.352 havoc Q chaos_bolt Fluffy_Pillow 49049.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:51.180 havoc R incinerate Fluffy_Pillow 49963.5/50000: 100% mana
1.1/5: 22% soul_shard
3:52.918 havoc N conflagrate Fluffy_Pillow 49001.0/50000: 98% mana
1.6/5: 32% soul_shard
3:54.225 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
3:56.051 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
3:57.790 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
1.9/5: 38% soul_shard
3:59.097 aoe F channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.1/5: 42% soul_shard
4:01.983 aoe G immolate enemy2 49598.0/50000: 99% mana
2.6/5: 52% soul_shard
4:03.292 aoe K conflagrate Fluffy_Pillow 49253.5/50000: 99% mana
2.6/5: 52% soul_shard
4:04.598 default 9 soul_fire Fluffy_Pillow 49406.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
4:08.077 aoe E soul_rot Fluffy_Pillow 49003.0/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
4:09.516 aoe G immolate enemy3 49472.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
4:10.822 aoe J rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
4:12.131 aoe L incinerate Fluffy_Pillow 49906.5/50000: 100% mana
2.3/5: 46% soul_shard
backdraft, soul_rot
4:13.351 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
soul_rot
4:14.659 aoe J rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft, soul_rot
4:15.966 aoe L incinerate Fluffy_Pillow 49810.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft, soul_rot
4:17.187 default A cataclysm Fluffy_Pillow 49003.0/50000: 98% mana
0.8/5: 16% soul_shard
soul_rot
4:18.927 aoe I havoc enemy2 49373.0/50000: 99% mana
1.0/5: 20% soul_shard
4:20.234 havoc N conflagrate Fluffy_Pillow 49026.5/50000: 98% mana
1.1/5: 22% soul_shard
4:21.539 havoc Q chaos_bolt Fluffy_Pillow 49179.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:23.367 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:25.108 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:26.848 havoc R incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.7/5: 34% soul_shard
4:28.587 havoc N conflagrate Fluffy_Pillow 48742.0/50000: 97% mana
2.3/5: 46% soul_shard
4:29.894 havoc P immolate Fluffy_Pillow 48895.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:31.202 aoe F channel_demonfire Fluffy_Pillow 48799.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:34.035 aoe G immolate enemy2 49466.0/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
4:35.340 aoe J rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:36.645 aoe L incinerate Fluffy_Pillow 49904.0/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
4:37.865 aoe G immolate enemy3 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:39.174 aoe K conflagrate Fluffy_Pillow 48907.0/50000: 98% mana
1.8/5: 36% soul_shard
4:40.481 aoe L incinerate Fluffy_Pillow 49060.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:41.701 aoe L incinerate Fluffy_Pillow 48670.5/50000: 97% mana
2.8/5: 56% soul_shard
4:43.442 aoe J rain_of_fire Fluffy_Pillow 48541.0/50000: 97% mana
3.4/5: 68% soul_shard
4:44.747 aoe K conflagrate Fluffy_Pillow 49193.5/50000: 98% mana
0.5/5: 10% soul_shard
4:46.079 aoe L incinerate Fluffy_Pillow 49359.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
4:47.300 aoe L incinerate Fluffy_Pillow 48970.0/50000: 98% mana
1.6/5: 32% soul_shard
4:49.040 default A cataclysm Fluffy_Pillow 48840.0/50000: 98% mana
2.1/5: 42% soul_shard
4:50.781 aoe I havoc enemy2 49210.5/50000: 98% mana
2.4/5: 48% soul_shard
4:52.087 havoc Q chaos_bolt Fluffy_Pillow 48863.5/50000: 98% mana
2.5/5: 50% soul_shard
4:54.696 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:56.004 havoc O soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
4:59.481 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:00.787 havoc Q chaos_bolt Fluffy_Pillow 48905.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
5:02.616 havoc N conflagrate Fluffy_Pillow 49819.5/50000: 100% mana
3.0/5: 60% soul_shard
5:03.921 aoe F channel_demonfire Fluffy_Pillow 49972.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:06.904 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
5:08.212 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
5:09.432 aoe E soul_rot Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
5:10.817 aoe G immolate enemy3 49445.0/50000: 99% mana
2.2/5: 44% soul_shard
soul_rot
5:12.123 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
soul_rot
5:13.429 aoe J rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
5:14.735 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NF_DuplicitousHavoc"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=208:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NF_InfernalBrand : 9610 dps, 5174 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9610.2 9610.2 18.3 / 0.190% 832.1 / 8.7% 21.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.7 386.0 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NF_InfernalBrand 9610
Cataclysm 776 8.1% 9.6 32.36sec 23947 14096 Direct 28.9 6701 13409 7984 19.1%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.63 28.89 0.00 0.00 1.6990 0.0000 230632.38 230632.38 0.00% 14095.61 14095.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 23.38 15 33 6701.08 6141 7261 6700.40 6512 6901 156630 156630 0.00%
crit 19.10% 5.52 0 13 13409.33 12283 14521 13398.58 0 14503 74003 74003 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.69
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1022) 0.0% (10.6%) 11.9 25.82sec 25450 9462

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.93 0.00 178.17 0.00 2.6898 0.1633 0.00 0.00 0.00% 9461.97 9461.97

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.94
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1022 10.6% 0.0 0.00sec 0 0 Direct 534.5 476 952 568 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 534.50 0.00 0.00 0.0000 0.0000 303672.45 303672.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 431.50 314 568 476.37 263 976 476.57 450 503 205542 205542 0.00%
crit 19.27% 103.00 52 146 952.42 525 1952 953.39 832 1136 98130 98130 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1233 (1683) 12.8% (17.5%) 21.6 13.19sec 23142 11792 Direct 42.9 (85.5) 0 8529 8529 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.58 42.93 0.00 0.00 1.9626 0.0000 366131.37 366131.37 0.00% 11791.53 11791.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.93 32 60 8528.62 5861 11548 8529.10 8296 8742 366131 366131 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.67
  • if_expr:cast_time<havoc_remains
    Internal Combustion 449 4.7% 42.6 13.25sec 3132 0 Direct 42.6 2623 5267 3133 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.55 42.55 0.00 0.00 0.0000 0.0000 133263.59 133263.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 34.36 24 55 2623.36 2 3715 2625.08 2397 2853 90132 90132 0.00%
crit 19.25% 8.19 2 18 5266.70 2 7430 5268.97 2614 6617 43131 43131 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 807 8.4% 36.6 7.93sec 6540 5231 Direct 56.2 3586 7142 4267 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.64 56.16 0.00 0.00 1.2503 0.0000 239621.16 239621.16 0.00% 5230.88 5230.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 45.41 31 61 3586.06 2047 5042 3585.96 3352 3853 162827 162827 0.00%
crit 19.14% 10.75 3 22 7141.69 4095 10084 7141.94 5114 9042 76794 76794 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.13
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.51
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1608 16.8% 26.5 10.91sec 18046 14309 Direct 33.6 1527 3057 1828 19.7%
Periodic 344.4 1015 2027 1211 19.4% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.51 33.64 344.42 344.42 1.2612 2.4831 478434.40 478434.40 0.00% 538.37 14308.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 27.03 16 37 1527.37 820 2017 1528.14 1393 1640 41289 41289 0.00%
crit 19.65% 6.61 1 17 3056.52 1639 4033 3059.93 2250 3992 20205 20205 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.64% 277.76 217 351 1014.59 0 1261 1014.65 997 1035 281819 281819 0.00%
crit 19.36% 66.66 42 98 2026.80 4 2521 2027.16 1918 2115 135122 135122 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.82
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.79
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 578 6.0% 44.3 6.10sec 3888 2656 Direct 54.7 (54.7) 2638 5268 3145 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.28 54.73 0.00 0.00 1.4641 0.0000 172156.14 172156.14 0.00% 2655.54 2655.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 44.17 28 67 2638.23 1312 3232 2640.59 2428 2876 116529 116529 0.00%
crit 19.29% 10.56 2 22 5268.16 2625 6464 5275.48 4171 6123 55627 55627 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.70
    havoc
    [R]:10.83
  • if_expr:cast_time<havoc_remains
Rain of Fire 910 9.5% 17.3 16.43sec 15643 12551 Periodic 410.0 553 1105 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.29 0.00 0.00 409.99 1.2464 0.0000 270410.68 270410.68 0.00% 12550.97 12550.97
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.68% 330.77 220 472 552.80 507 599 552.77 546 559 182840 182840 0.00%
crit 19.32% 79.22 49 120 1105.49 1013 1198 1105.35 1079 1127 87571 87571 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.31
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:11.99
Soul Fire 512 5.3% 5.5 49.38sec 27543 7921 Direct 7.8 16406 32794 19602 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.77 0.00 0.00 3.4775 0.0000 152111.63 152111.63 0.00% 7920.83 7920.83
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 6.26 2 10 16406.35 8604 21177 16442.04 13505 19885 102692 102692 0.00%
crit 19.42% 1.51 0 5 32794.48 17221 42313 26599.03 0 42112 49419 49419 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.30
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.32
  • if_expr:cast_time<havoc_remains
Soul Rot 341 3.6% 5.2 62.42sec 19346 15487 Periodic 96.0 883 1768 1056 19.6% 13.9%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.24 0.00 95.99 95.99 1.2493 1.2891 101363.26 101363.26 0.00% 778.03 15487.13
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.42% 77.19 52 99 882.82 424 1395 883.15 830 937 68155 68155 0.00%
crit 19.58% 18.80 9 36 1767.76 849 2790 1765.01 1353 2179 33209 33209 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.26
Summon Infernal 80 0.8% 2.0 180.53sec 11805 10208 Direct 6.0 3348 6696 3940 17.5%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23610.31 23610.31 0.00% 10207.66 10207.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.47% 4.95 1 6 3348.13 3348 3348 3348.13 3348 3348 16567 16567 0.00%
crit 17.53% 1.05 0 5 6696.27 6696 6696 4615.88 0 6696 7043 7043 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3814 / 780
Immolation 3548 7.5% 39.0 5.49sec 5459 0 Direct 117.0 1529 3063 1820 19.0%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 212905.63 212905.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 94.80 80 109 1528.68 1395 2023 1528.71 1499 1553 144926 144926 0.00%
crit 18.97% 22.20 8 37 3062.78 2790 4046 3061.25 2854 3281 67979 67979 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15955.74 22791.19 29.99% 270.88 270.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 32.99 25 39 325.55 326 326 325.55 326 326 10740 15340 29.99%
crit 19.54% 8.01 2 16 651.10 651 651 651.10 651 651 5216 7451 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1651 1135 Direct 91.9 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152930.22 152930.22 0.00% 1134.57 1134.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.12 51 99 1395.06 1395 1395 1395.06 1395 1395 103408 103408 0.00%
crit 19.32% 17.75 5 30 2790.11 2790 2790 2790.11 2790 2790 49522 49522 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
NF_InfernalBrand
Havoc 9.6 31.97sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 0.00 0.00 0.00 1.2439 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.59
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.1sec 50.50% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.50%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.2 0.0 62.4sec 62.4sec 7.9sec 13.90% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.3s
  • trigger_min/max:61.3s / 68.3s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 8.0s

Stack Uptimes

  • soul_rot_1:13.90%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NF_InfernalBrand_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 185.2s
  • trigger_min/max:180.0s / 185.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NF_InfernalBrand_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 185.2s
  • trigger_min/max:180.0s / 185.2s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.18% 10.47% 17.52% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NF_InfernalBrand
soul_fire Soul Shard 6.53 7.13 7.55% 1.09 0.70 8.99%
immolate Soul Shard 344.49 33.31 35.29% 0.10 1.14 3.30%
incinerate Soul Shard 44.33 11.02 11.67% 0.25 0.01 0.06%
conflagrate Soul Shard 36.63 28.07 29.74% 0.77 0.00 0.00%
mana_regen Mana 653.73 114921.44 100.00% 175.79 33603.12 22.62%
immolate_crits Soul Shard 33.56 3.25 3.44% 0.10 0.11 3.21%
incinerate_crits Soul Shard 10.56 1.06 1.12% 0.10 0.00 0.07%
infernal Soul Shard 120.00 10.56 11.19% 0.09 1.44 11.97%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.03 388.72 33624.3 49200.1 47867.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NF_InfernalBrand
cataclysm Mana 9.6 4820.2 500.0 500.5 47.8
channel_demonfire Mana 11.9 8952.7 750.0 750.3 33.9
chaos_bolt Soul Shard 21.6 43.1 2.0 2.0 11586.6
conflagrate Mana 36.6 18316.2 500.0 499.9 13.1
havoc Mana 9.6 9591.5 1000.0 1000.3 0.0
immolate Mana 26.5 19872.6 750.0 749.6 24.1
incinerate Mana 44.3 44326.5 1000.0 1001.1 3.9
rain_of_fire Soul Shard 17.3 51.9 3.0 3.0 5209.4
soul_fire Mana 6.5 6531.5 1000.0 1182.7 23.3
soul_rot Mana 5.2 1308.4 250.0 249.7 77.5
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.8
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NF_InfernalBrand Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
NF_InfernalBrand Damage Per Second
Count 618
Mean 9610.15
Minimum 8964.76
Maximum 10444.13
Spread ( max - min ) 1479.38
Range [ ( max - min ) / 2 * 100% ] 7.70%
Standard Deviation 231.5999
5th Percentile 9253.12
95th Percentile 9989.01
( 95th Percentile - 5th Percentile ) 735.88
Mean Distribution
Standard Deviation 9.3163
95.00% Confidence Interval ( 9591.89 - 9628.41 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2232
0.1 Scale Factor Error with Delta=300 458
0.05 Scale Factor Error with Delta=300 1832
0.01 Scale Factor Error with Delta=300 45789
Priority Target DPS
NF_InfernalBrand Priority Target Damage Per Second
Count 618
Mean 5173.53
Minimum 4845.80
Maximum 5637.46
Spread ( max - min ) 791.66
Range [ ( max - min ) / 2 * 100% ] 7.65%
Standard Deviation 133.7472
5th Percentile 4968.05
95th Percentile 5399.07
( 95th Percentile - 5th Percentile ) 431.02
Mean Distribution
Standard Deviation 5.3801
95.00% Confidence Interval ( 5162.98 - 5184.07 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2568
0.1 Scale Factor Error with Delta=300 153
0.05 Scale Factor Error with Delta=300 611
0.01 Scale Factor Error with Delta=300 15271
DPS(e)
NF_InfernalBrand Damage Per Second (Effective)
Count 618
Mean 9610.15
Minimum 8964.76
Maximum 10444.13
Spread ( max - min ) 1479.38
Range [ ( max - min ) / 2 * 100% ] 7.70%
Damage
NF_InfernalBrand Damage
Count 618
Mean 2471407.37
Minimum 2021747.06
Maximum 2993178.96
Spread ( max - min ) 971431.89
Range [ ( max - min ) / 2 * 100% ] 19.65%
DTPS
NF_InfernalBrand Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NF_InfernalBrand Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NF_InfernalBrand Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NF_InfernalBrand Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NF_InfernalBrand Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NF_InfernalBrand Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NF_InfernalBrandTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NF_InfernalBrand Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.30 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.69 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.31 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.26 soul_rot
F 11.94 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.82 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.59 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 11.99 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.13 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.70 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.51 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.32 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.79 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.67 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.83 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGDGLKLLDKALLJFIRNQNOPJGLKJFLKLAELJIRNQRNPRFGJKLLLL9AIQNQNQPFKJLLGGGKLLEJAINQRNQRP9FGGJKLKLLJAIRNQRNQPFGKLGMLDEKL9AIQNQQNPDFGLGKJLLKLLAIQNQPRRN9FGEGJKLJKAIRQRNQPFKLLGLJKLGGL9AFIQNQNPQNEL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E soul_rot Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:05.047 cds M summon_infernal Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, soul_rot
0:06.054 aoe I havoc enemy2 49503.5/50000: 99% mana
4.8/5: 96% soul_shard
bloodlust, soul_rot
0:07.060 havoc Q chaos_bolt Fluffy_Pillow 49006.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:09.068 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:10.077 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft, soul_rot
0:11.484 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:12.491 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.497 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:14.905 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.913 havoc Q chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:17.319 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:18.324 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:19.329 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:21.779 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.786 aoe G immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.793 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.800 aoe G immolate enemy3 49509.5/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:25.807 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
bloodlust, backdraft
0:26.744 aoe K conflagrate Fluffy_Pillow 48721.0/50000: 97% mana
1.2/5: 24% soul_shard
bloodlust
0:27.752 aoe L incinerate Fluffy_Pillow 48725.0/50000: 97% mana
2.1/5: 42% soul_shard
bloodlust, backdraft
0:28.692 aoe L incinerate Fluffy_Pillow 48195.0/50000: 96% mana
2.7/5: 54% soul_shard
bloodlust
0:30.032 aoe D rain_of_fire Fluffy_Pillow 47865.0/50000: 96% mana
3.4/5: 68% soul_shard
bloodlust
0:31.039 aoe K conflagrate Fluffy_Pillow 48368.5/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:32.047 default A cataclysm Fluffy_Pillow 48372.5/50000: 97% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:33.387 aoe L incinerate Fluffy_Pillow 48542.5/50000: 97% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:34.326 aoe L incinerate Fluffy_Pillow 48012.0/50000: 96% mana
2.6/5: 52% soul_shard
bloodlust
0:35.666 aoe J rain_of_fire Fluffy_Pillow 47682.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:36.674 aoe F channel_demonfire Fluffy_Pillow 48186.0/50000: 96% mana
0.3/5: 6% soul_shard
bloodlust
0:39.026 aoe I havoc enemy2 48612.0/50000: 97% mana
0.7/5: 14% soul_shard
bloodlust
0:40.032 havoc R incinerate Fluffy_Pillow 48115.0/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:41.372 havoc N conflagrate Fluffy_Pillow 47785.0/50000: 96% mana
1.4/5: 28% soul_shard
0:42.678 havoc Q chaos_bolt Fluffy_Pillow 47938.0/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
0:44.505 havoc N conflagrate Fluffy_Pillow 48851.5/50000: 98% mana
1.1/5: 22% soul_shard
0:45.810 havoc O soul_fire Fluffy_Pillow 49004.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
0:49.287 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
0:50.595 aoe J rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:51.904 aoe G immolate enemy3 49560.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
0:53.212 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:54.430 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.5/5: 50% soul_shard
0:55.737 aoe J rain_of_fire Fluffy_Pillow 49015.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
0:57.043 aoe F channel_demonfire Fluffy_Pillow 49668.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
0:59.890 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:01.111 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
1:02.419 aoe L incinerate Fluffy_Pillow 49157.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
1:03.639 default A cataclysm Fluffy_Pillow 48767.0/50000: 98% mana
2.4/5: 48% soul_shard
1:05.378 aoe E soul_rot Fluffy_Pillow 49136.5/50000: 98% mana
2.7/5: 54% soul_shard
1:06.683 aoe L incinerate Fluffy_Pillow 49539.0/50000: 99% mana
2.7/5: 54% soul_shard
soul_rot
1:08.425 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
1:09.732 aoe I havoc enemy2 49656.5/50000: 99% mana
0.3/5: 6% soul_shard
soul_rot
1:11.037 havoc R incinerate Fluffy_Pillow 49309.0/50000: 99% mana
0.6/5: 12% soul_shard
soul_rot
1:12.779 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.0/5: 20% soul_shard
soul_rot
1:14.086 havoc Q chaos_bolt Fluffy_Pillow 49156.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft, soul_rot
1:15.914 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:17.654 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:18.961 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:20.268 havoc R incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:21.487 aoe F channel_demonfire Fluffy_Pillow 48668.5/50000: 97% mana
3.2/5: 64% soul_shard
1:24.372 aoe G immolate enemy3 49361.0/50000: 99% mana
3.6/5: 72% soul_shard
1:25.679 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
1:26.986 aoe K conflagrate Fluffy_Pillow 49906.0/50000: 100% mana
0.9/5: 18% soul_shard
1:28.292 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
backdraft
1:29.511 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
1:31.251 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
2.4/5: 48% soul_shard
1:32.993 aoe L incinerate Fluffy_Pillow 48743.0/50000: 97% mana
2.9/5: 58% soul_shard
1:34.735 default 9 soul_fire Fluffy_Pillow 48614.0/50000: 97% mana
3.4/5: 68% soul_shard
1:38.212 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.8/5: 96% soul_shard
1:39.952 aoe I havoc enemy2 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
1:41.259 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
5.0/5: 100% soul_shard
1:43.868 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
1:45.175 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
backdraft
1:47.004 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
1:48.311 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
1:50.139 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
1:51.445 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
1:54.247 aoe K conflagrate Fluffy_Pillow 49903.0/50000: 100% mana
2.6/5: 52% soul_shard
1:55.554 aoe J rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:56.859 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:58.078 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
1:59.817 aoe G immolate enemy3 48871.5/50000: 98% mana
1.2/5: 24% soul_shard
2:01.123 aoe G immolate enemy2 48774.5/50000: 98% mana
1.4/5: 28% soul_shard
2:02.430 aoe G immolate Fluffy_Pillow 48678.0/50000: 97% mana
1.6/5: 32% soul_shard
2:03.737 aoe K conflagrate Fluffy_Pillow 48581.5/50000: 97% mana
1.8/5: 36% soul_shard
2:05.045 aoe L incinerate Fluffy_Pillow 48735.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
2:06.264 aoe L incinerate Fluffy_Pillow 48345.0/50000: 97% mana
2.8/5: 56% soul_shard
2:08.005 aoe E soul_rot Fluffy_Pillow 48215.5/50000: 96% mana
3.3/5: 66% soul_shard
2:09.311 aoe J rain_of_fire Fluffy_Pillow 48618.5/50000: 97% mana
3.3/5: 66% soul_shard
soul_rot
2:10.618 default A cataclysm Fluffy_Pillow 49272.0/50000: 99% mana
0.7/5: 14% soul_shard
soul_rot
2:12.358 aoe I havoc enemy2 49502.0/50000: 99% mana
0.9/5: 18% soul_shard
soul_rot
2:13.662 havoc N conflagrate Fluffy_Pillow 49154.0/50000: 98% mana
1.1/5: 22% soul_shard
soul_rot
2:14.969 havoc Q chaos_bolt Fluffy_Pillow 49307.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft, soul_rot
2:16.798 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
soul_rot
2:18.539 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:19.845 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:21.672 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.414 havoc P immolate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
2:24.722 default 9 soul_fire Fluffy_Pillow 48907.0/50000: 98% mana
1.2/5: 24% soul_shard
2:28.201 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
2:30.957 aoe G immolate enemy2 49631.0/50000: 99% mana
3.0/5: 60% soul_shard
2:32.264 aoe G immolate enemy3 49252.5/50000: 99% mana
3.3/5: 66% soul_shard
2:33.570 aoe J rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.3/5: 66% soul_shard
2:34.877 aoe K conflagrate Fluffy_Pillow 49809.0/50000: 100% mana
0.6/5: 12% soul_shard
2:36.184 aoe L incinerate Fluffy_Pillow 49962.5/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:37.403 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
2:38.709 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:39.930 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
2.7/5: 54% soul_shard
2:41.670 aoe J rain_of_fire Fluffy_Pillow 48635.5/50000: 97% mana
3.2/5: 64% soul_shard
2:42.974 default A cataclysm Fluffy_Pillow 49287.5/50000: 99% mana
0.3/5: 6% soul_shard
2:44.715 aoe I havoc enemy2 49502.5/50000: 99% mana
0.5/5: 10% soul_shard
2:46.019 havoc R incinerate Fluffy_Pillow 49154.5/50000: 98% mana
0.6/5: 12% soul_shard
2:47.759 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:49.064 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:50.891 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
2:52.630 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
2:53.936 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:55.763 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:57.069 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
2:59.925 aoe G immolate enemy2 49930.0/50000: 100% mana
1.2/5: 24% soul_shard
3:01.231 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
3:02.539 aoe L incinerate Fluffy_Pillow 49406.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:03.761 aoe G immolate enemy3 49003.5/50000: 98% mana
2.3/5: 46% soul_shard
3:05.066 cds M summon_infernal Fluffy_Pillow 48906.0/50000: 98% mana
2.5/5: 50% soul_shard
3:06.373 aoe L incinerate Fluffy_Pillow 48559.5/50000: 97% mana
2.9/5: 58% soul_shard
3:08.114 aoe D rain_of_fire Fluffy_Pillow 48430.0/50000: 97% mana
3.8/5: 76% soul_shard
3:09.421 aoe E soul_rot Fluffy_Pillow 49083.5/50000: 98% mana
1.1/5: 22% soul_shard
3:10.729 aoe K conflagrate Fluffy_Pillow 49487.5/50000: 99% mana
1.6/5: 32% soul_shard
soul_rot
3:12.034 aoe L incinerate Fluffy_Pillow 49640.0/50000: 99% mana
2.4/5: 48% soul_shard
backdraft, soul_rot
3:13.251 default 9 soul_fire Fluffy_Pillow 49001.0/50000: 98% mana
3.2/5: 64% soul_shard
soul_rot
3:16.728 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot
3:18.468 aoe I havoc enemy2 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
soul_rot
3:19.774 havoc Q chaos_bolt Fluffy_Pillow 49025.0/50000: 98% mana
5.0/5: 100% soul_shard
3:22.384 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.690 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:25.518 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.125 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
3:29.433 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
3:30.740 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
3:32.046 aoe F channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:34.926 aoe G immolate enemy2 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
3:36.231 aoe L incinerate Fluffy_Pillow 49251.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
3:37.449 aoe G immolate enemy3 48860.5/50000: 98% mana
2.3/5: 46% soul_shard
3:38.755 aoe K conflagrate Fluffy_Pillow 48763.5/50000: 98% mana
2.4/5: 48% soul_shard
3:40.061 aoe J rain_of_fire Fluffy_Pillow 48916.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
3:41.367 aoe L incinerate Fluffy_Pillow 49569.5/50000: 99% mana
0.3/5: 6% soul_shard
backdraft
3:42.588 aoe L incinerate Fluffy_Pillow 49003.0/50000: 98% mana
0.7/5: 14% soul_shard
3:44.329 aoe K conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.3/5: 26% soul_shard
3:45.669 aoe L incinerate Fluffy_Pillow 49043.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:46.889 aoe L incinerate Fluffy_Pillow 48653.5/50000: 97% mana
2.5/5: 50% soul_shard
3:48.629 default A cataclysm Fluffy_Pillow 48523.5/50000: 97% mana
2.7/5: 54% soul_shard
3:50.370 aoe I havoc enemy2 48894.0/50000: 98% mana
3.1/5: 62% soul_shard
3:51.675 havoc Q chaos_bolt Fluffy_Pillow 48546.5/50000: 97% mana
3.1/5: 62% soul_shard
3:54.284 havoc N conflagrate Fluffy_Pillow 49851.0/50000: 100% mana
1.4/5: 28% soul_shard
3:55.589 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
3:57.418 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
3:58.723 havoc R incinerate Fluffy_Pillow 49251.5/50000: 99% mana
1.1/5: 22% soul_shard
4:00.463 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
4:02.203 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.2/5: 44% soul_shard
4:03.508 default 9 soul_fire Fluffy_Pillow 49024.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:06.986 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
4:09.897 aoe G immolate enemy3 49708.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:11.204 aoe E soul_rot Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:12.510 aoe G immolate enemy2 49655.5/50000: 99% mana
5.0/5: 100% soul_shard
soul_rot
4:13.817 aoe J rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
5.0/5: 100% soul_shard
soul_rot
4:15.123 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.0/5: 40% soul_shard
soul_rot
4:16.430 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
4:17.649 aoe J rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
soul_rot
4:18.954 aoe K conflagrate Fluffy_Pillow 49654.5/50000: 99% mana
0.3/5: 6% soul_shard
soul_rot
4:20.265 default A cataclysm Fluffy_Pillow 49810.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, soul_rot
4:22.105 aoe I havoc enemy2 49502.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
4:23.412 havoc R incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
4:24.629 havoc Q chaos_bolt Fluffy_Pillow 48764.0/50000: 98% mana
2.0/5: 40% soul_shard
4:27.238 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:28.979 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
4:30.285 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:32.113 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:33.422 aoe F channel_demonfire Fluffy_Pillow 49253.5/50000: 99% mana
0.6/5: 12% soul_shard
4:36.273 aoe K conflagrate Fluffy_Pillow 49929.0/50000: 100% mana
1.0/5: 20% soul_shard
4:37.579 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
4:38.798 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
4:40.537 aoe G immolate enemy3 48871.5/50000: 98% mana
2.5/5: 50% soul_shard
4:41.841 aoe L incinerate Fluffy_Pillow 48773.5/50000: 98% mana
2.7/5: 54% soul_shard
4:43.582 aoe J rain_of_fire Fluffy_Pillow 48644.0/50000: 97% mana
3.0/5: 60% soul_shard
4:44.887 aoe K conflagrate Fluffy_Pillow 49296.5/50000: 99% mana
0.2/5: 4% soul_shard
4:46.211 aoe L incinerate Fluffy_Pillow 49458.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
4:47.431 aoe G immolate enemy2 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:48.736 aoe G immolate Fluffy_Pillow 48905.0/50000: 98% mana
1.3/5: 26% soul_shard
4:50.043 aoe L incinerate Fluffy_Pillow 48808.5/50000: 98% mana
1.5/5: 30% soul_shard
4:51.783 default 9 soul_fire Fluffy_Pillow 48678.5/50000: 97% mana
2.0/5: 40% soul_shard
4:55.459 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
3.5/5: 70% soul_shard
4:57.199 aoe F channel_demonfire Fluffy_Pillow 49372.5/50000: 99% mana
3.9/5: 78% soul_shard
5:00.051 aoe I havoc enemy2 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
5:01.357 havoc Q chaos_bolt Fluffy_Pillow 49653.0/50000: 99% mana
4.3/5: 86% soul_shard
5:03.968 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
5:05.274 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.8/5: 76% soul_shard
backdraft
5:07.102 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
5:08.409 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
5:09.715 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
5:11.544 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:12.851 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
5:14.157 aoe L incinerate Fluffy_Pillow 49752.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NF_InfernalBrand"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=214:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

NF_SoulEater : 9679 dps, 5180 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9678.8 9678.8 16.9 / 0.174% 757.3 / 7.8% 21.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
388.9 386.2 Mana 0.00% 38.5 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NF_SoulEater 9679
Cataclysm 778 8.1% 9.6 32.39sec 24044 14153 Direct 28.9 6701 13405 8013 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.62 28.87 0.00 0.00 1.6989 0.0000 231411.52 231411.52 0.00% 14152.74 14152.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 23.22 15 34 6701.32 6142 7261 6701.97 6509 6951 155618 155618 0.00%
crit 19.58% 5.65 0 13 13404.85 12284 14521 13355.07 0 14446 75793 75793 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.70
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1023) 0.0% (10.6%) 11.9 25.46sec 25468 9467

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.93 0.00 178.23 0.00 2.6901 0.1633 0.00 0.00 0.00% 9467.41 9467.41

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [F]:11.94
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1023 10.6% 0.0 0.00sec 0 0 Direct 534.7 476 954 568 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 534.67 0.00 0.00 0.0000 0.0000 303922.75 303922.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 430.93 314 588 475.68 263 976 475.90 450 506 204990 204990 0.00%
crit 19.40% 103.74 64 155 953.55 525 1952 953.84 828 1093 98933 98933 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1232 (1680) 12.7% (17.3%) 21.6 13.36sec 23117 11793 Direct 42.9 (85.5) 0 8521 8521 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.57 42.92 0.00 0.00 1.9602 0.0000 365763.29 365763.29 0.00% 11793.22 11793.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.92 32 58 8521.45 5861 11548 8521.79 8336 8713 365763 365763 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:21.68
  • if_expr:cast_time<havoc_remains
    Internal Combustion 448 4.6% 42.6 13.33sec 3122 0 Direct 42.6 2621 5254 3122 19.1%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.57 42.57 0.00 0.00 0.0000 0.0000 132901.30 132901.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 34.46 21 50 2620.73 1 3715 2622.61 2389 2850 90298 90298 0.00%
crit 19.06% 8.11 1 19 5254.11 198 7425 5256.85 510 6329 42603 42603 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 809 8.4% 36.6 7.95sec 6566 5251 Direct 56.1 3580 7189 4286 19.6%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.62 56.12 0.00 0.00 1.2503 0.0000 240451.11 240451.11 0.00% 5251.17 5251.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 45.15 31 59 3580.39 2047 5042 3581.21 3369 3927 161651 161651 0.00%
crit 19.55% 10.97 4 25 7188.96 4095 10084 7186.74 5693 8840 78800 78800 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:17.13
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.49
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1608 16.6% 26.5 10.87sec 18058 14318 Direct 33.7 1525 3056 1818 19.2%
Periodic 344.6 1014 2029 1210 19.3% 95.8%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.48 33.68 344.56 344.56 1.2612 2.4827 478209.96 478209.96 0.00% 538.02 14318.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 27.22 17 41 1524.78 819 2017 1524.84 1387 1642 41494 41494 0.00%
crit 19.18% 6.46 0 14 3055.63 1643 4033 3047.58 0 3929 19745 19745 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 277.94 210 353 1013.77 1 1261 1013.86 992 1037 281762 281762 0.00%
crit 19.33% 66.62 37 104 2029.44 2 2521 2029.62 1920 2128 135208 135208 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [G]:17.80
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.78
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 579 6.0% 44.4 6.11sec 3889 2656 Direct 54.9 (54.9) 2637 5277 3144 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.38 54.87 0.00 0.00 1.4644 0.0000 172567.27 172567.27 0.00% 2655.62 2655.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 44.33 25 65 2637.36 1312 3232 2639.93 2439 2824 116925 116925 0.00%
crit 19.21% 10.54 2 21 5277.49 2625 6464 5286.15 3877 6234 55642 55642 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:33.73
    havoc
    [R]:10.88
  • if_expr:cast_time<havoc_remains
Rain of Fire 910 9.4% 17.3 16.25sec 15645 12552 Periodic 409.8 553 1105 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.29 0.00 0.00 409.78 1.2464 0.0000 270463.31 270463.31 0.00% 12551.67 12551.67
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.58% 330.22 218 442 552.75 507 599 552.75 545 560 182531 182531 0.00%
crit 19.42% 79.56 43 118 1105.14 1013 1198 1105.18 1085 1127 87933 87933 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.32
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [J]:11.97
Soul Fire 513 5.3% 5.5 49.41sec 27654 7953 Direct 7.8 16395 33253 19671 19.3%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.76 0.00 0.00 3.4775 0.0000 152545.63 152545.63 0.00% 7952.54 7952.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 6.26 2 10 16394.92 8604 21177 16449.33 12947 19893 102685 102685 0.00%
crit 19.32% 1.50 0 5 33253.43 17249 42346 26828.44 0 42334 49861 49861 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.32
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.31
  • if_expr:cast_time<havoc_remains
Soul Rot 467 4.8% 5.2 62.48sec 26624 21319 Periodic 95.8 1214 2426 1450 19.4% 13.8%

Stats Details: Soul Rot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 95.83 95.83 1.2490 1.2896 138894.82 138894.82 0.00% 1067.65 21319.24
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.59% 77.23 52 101 1214.23 583 1918 1214.80 1129 1282 93785 93785 0.00%
crit 19.41% 18.60 8 32 2426.23 1167 3836 2426.58 1853 3114 45110 45110 0.00%

Action Details: Soul Rot

  • id:325640
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:4
  • harmful:true

Resources

  • resource:mana
  • base_cost:250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:325640
  • name:Soul Rot
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.

Action Priority List

    aoe
    [E]:5.24
Summon Infernal 82 0.8% 2.0 180.66sec 11989 10367 Direct 6.0 3348 6696 3998 19.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23978.71 23978.71 0.00% 10366.93 10366.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 4.84 1 6 3348.13 3348 3348 3348.13 3348 3348 16199 16199 0.00%
crit 19.36% 1.16 0 5 6696.27 6696 6696 4767.57 0 6696 7780 7780 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3504 / 716
Immolation 3239 6.8% 39.0 5.50sec 4983 0 Direct 117.0 1395 2790 1661 19.1%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194330.43 194330.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 94.70 81 107 1395.06 1395 1395 1395.06 1395 1395 132113 132113 0.00%
crit 19.06% 22.30 10 36 2790.11 2790 2790 2790.11 2790 2790 62218 62218 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15902.01 22714.44 29.99% 269.96 269.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 33.15 26 40 325.55 326 326 325.55 326 326 10793 15417 29.99%
crit 19.14% 7.85 1 15 651.10 651 651 651.10 651 651 5109 7297 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.3% 92.6 3.21sec 1653 1136 Direct 91.9 1395 2790 1667 19.5%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 153128.87 153128.87 0.00% 1136.05 1136.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 73.98 55 96 1395.06 1395 1395 1395.06 1395 1395 103209 103209 0.00%
crit 19.47% 17.89 6 33 2790.11 2790 2790 2790.11 2790 2790 49920 49920 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
NF_SoulEater
Havoc 9.6 32.05sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 0.00 0.00 0.00 1.2438 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [I]:9.58
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.6 0.0 8.0sec 8.0sec 4.1sec 50.28% 0.00% 0.0 (0.0) 1.4

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 24.2s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:50.28%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Soul Rot 5.2 0.0 62.4sec 62.4sec 7.9sec 13.88% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_soul_rot
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:hasted
  • period:0.00

Trigger Details

  • interval_min/max:61.3s / 68.3s
  • trigger_min/max:61.3s / 68.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • soul_rot_1:13.88%

Spelldata

  • id:325640
  • name:Soul Rot
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Wither away all life force of your current target and up to {$s3=3} additional targets nearby, causing your primary target to suffer ${$o2*(1+$m4/10)} Nature damage and secondary targets to suffer $o2 Nature damage over {$d=8 seconds}. For the next {$d=8 seconds}, casting Drain Life will cause you to also Drain Life from any enemy affected by your Soul Rot, and Drain Life will not consume any mana.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:NF_SoulEater_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.6s
  • trigger_min/max:180.0s / 187.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:NF_SoulEater_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.6s
  • trigger_min/max:180.0s / 187.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.14% 11.16% 17.35% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NF_SoulEater
soul_fire Soul Shard 6.53 7.10 7.53% 1.09 0.72 9.20%
immolate Soul Shard 344.63 33.33 35.34% 0.10 1.13 3.28%
incinerate Soul Shard 44.39 11.03 11.70% 0.25 0.01 0.10%
conflagrate Soul Shard 36.62 28.05 29.75% 0.77 0.00 0.00%
mana_regen Mana 653.66 114957.56 100.00% 175.87 33562.05 22.60%
immolate_crits Soul Shard 32.99 3.20 3.39% 0.10 0.10 3.04%
incinerate_crits Soul Shard 10.53 1.05 1.12% 0.10 0.00 0.12%
infernal Soul Shard 120.00 10.55 11.18% 0.09 1.45 12.12%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 386.20 388.85 33566.5 49211.3 47866.0 50000.0
Soul Shard 4.0 0.32 0.32 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
NF_SoulEater
cataclysm Mana 9.6 4817.0 500.0 500.5 48.0
channel_demonfire Mana 11.9 8952.7 750.0 750.2 33.9
chaos_bolt Soul Shard 21.6 43.1 2.0 2.0 11562.9
conflagrate Mana 36.6 18310.7 500.0 500.0 13.1
havoc Mana 9.6 9580.4 1000.0 1000.3 0.0
immolate Mana 26.5 19862.0 750.0 750.0 24.1
incinerate Mana 44.4 44394.3 1000.0 1000.4 3.9
rain_of_fire Soul Shard 17.3 51.9 3.0 3.0 5215.1
soul_fire Mana 6.5 6525.2 1000.0 1182.9 23.4
soul_rot Mana 5.2 1302.8 250.0 249.7 106.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
NF_SoulEater Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
NF_SoulEater Damage Per Second
Count 618
Mean 9678.84
Minimum 9187.72
Maximum 10290.63
Spread ( max - min ) 1102.91
Range [ ( max - min ) / 2 * 100% ] 5.70%
Standard Deviation 213.8398
5th Percentile 9354.57
95th Percentile 10035.27
( 95th Percentile - 5th Percentile ) 680.71
Mean Distribution
Standard Deviation 8.6019
95.00% Confidence Interval ( 9661.98 - 9695.70 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1876
0.1 Scale Factor Error with Delta=300 391
0.05 Scale Factor Error with Delta=300 1562
0.01 Scale Factor Error with Delta=300 39036
Priority Target DPS
NF_SoulEater Priority Target Damage Per Second
Count 618
Mean 5180.45
Minimum 4897.35
Maximum 5527.64
Spread ( max - min ) 630.29
Range [ ( max - min ) / 2 * 100% ] 6.08%
Standard Deviation 127.2165
5th Percentile 4986.23
95th Percentile 5408.80
( 95th Percentile - 5th Percentile ) 422.57
Mean Distribution
Standard Deviation 5.1174
95.00% Confidence Interval ( 5170.42 - 5190.48 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2317
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 553
0.01 Scale Factor Error with Delta=300 13816
DPS(e)
NF_SoulEater Damage Per Second (Effective)
Count 618
Mean 9678.84
Minimum 9187.72
Maximum 10290.63
Spread ( max - min ) 1102.91
Range [ ( max - min ) / 2 * 100% ] 5.70%
Damage
NF_SoulEater Damage
Count 618
Mean 2511109.67
Minimum 2017692.33
Maximum 3025888.01
Spread ( max - min ) 1008195.67
Range [ ( max - min ) / 2 * 100% ] 20.07%
DTPS
NF_SoulEater Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NF_SoulEater Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NF_SoulEater Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NF_SoulEater Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NF_SoulEater Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NF_SoulEater Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NF_SoulEaterTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NF_SoulEater Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.32 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.70 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.32 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
E 5.24 soul_rot
F 11.94 channel_demonfire,if=dot.immolate.remains>cast_time
G 17.80 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
H 0.00 call_action_list,name=cds
I 9.58 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
J 11.97 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 17.13 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 33.73 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.49 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.31 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.78 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 21.68 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.88 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEFMIQNQNPQNQNDFGGGDLKLLDKALLKFIQQPNOJLGKJLFKLEALLINQQPNQFLGGGKLLJ9AINQNQRQPFGKGLKGEJLLKAIQRNQRP9FJGKLKLGLJLAINQRRNQPFGKLGEMDKL9AIQNQQNPDFGLGJKLLLKLAIQNQPRRN9FEGGJKLJLAINQRNQRPFGKLGJLKLLLLA9FIQNQNPQNEG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E soul_rot Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:02.747 aoe F channel_demonfire Fluffy_Pillow 49623.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust, soul_rot
0:04.939 cds M summon_infernal Fluffy_Pillow 49969.5/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, soul_rot
0:05.944 aoe I havoc enemy2 49472.0/50000: 99% mana
4.9/5: 98% soul_shard
bloodlust, soul_rot
0:06.950 havoc Q chaos_bolt Fluffy_Pillow 48975.0/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust, soul_rot
0:08.960 havoc N conflagrate Fluffy_Pillow 49980.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust, soul_rot
0:09.965 havoc Q chaos_bolt Fluffy_Pillow 49982.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft, soul_rot
0:11.371 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:12.377 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:13.383 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:14.788 havoc N conflagrate Fluffy_Pillow 49954.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.794 havoc Q chaos_bolt Fluffy_Pillow 49957.5/50000: 100% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:17.201 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:18.207 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:19.213 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:21.679 aoe G immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:22.685 aoe G immolate enemy2 49252.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:23.691 aoe G immolate enemy3 49005.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:24.696 aoe D rain_of_fire Fluffy_Pillow 48757.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:25.701 aoe L incinerate Fluffy_Pillow 49260.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.640 aoe K conflagrate Fluffy_Pillow 48729.5/50000: 97% mana
1.0/5: 20% soul_shard
bloodlust
0:27.648 aoe L incinerate Fluffy_Pillow 48733.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.587 aoe L incinerate Fluffy_Pillow 48203.0/50000: 96% mana
2.4/5: 48% soul_shard
bloodlust
0:29.927 aoe D rain_of_fire Fluffy_Pillow 47873.0/50000: 96% mana
3.1/5: 62% soul_shard
bloodlust
0:30.933 aoe K conflagrate Fluffy_Pillow 48376.0/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust
0:31.941 default A cataclysm Fluffy_Pillow 48380.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:33.282 aoe L incinerate Fluffy_Pillow 48550.5/50000: 97% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:34.221 aoe L incinerate Fluffy_Pillow 48020.0/50000: 96% mana
2.5/5: 50% soul_shard
bloodlust
0:35.563 aoe K conflagrate Fluffy_Pillow 47691.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:36.578 aoe F channel_demonfire Fluffy_Pillow 47698.5/50000: 95% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.818 aoe I havoc enemy2 48068.5/50000: 96% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:39.826 havoc Q chaos_bolt Fluffy_Pillow 47572.5/50000: 95% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:41.232 havoc Q chaos_bolt Fluffy_Pillow 48275.5/50000: 97% mana
2.7/5: 54% soul_shard
0:43.842 havoc P immolate Fluffy_Pillow 49580.5/50000: 99% mana
1.0/5: 20% soul_shard
0:45.150 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.2/5: 24% soul_shard
0:46.457 havoc O soul_fire Fluffy_Pillow 49406.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:49.935 aoe J rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:51.241 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
0:52.460 aoe G immolate enemy3 49002.0/50000: 98% mana
2.3/5: 46% soul_shard
0:53.766 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.4/5: 48% soul_shard
0:55.073 aoe J rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:56.381 aoe L incinerate Fluffy_Pillow 49712.5/50000: 99% mana
0.2/5: 4% soul_shard
backdraft
0:57.600 aoe F channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
0.6/5: 12% soul_shard
1:00.290 aoe K conflagrate Fluffy_Pillow 49597.0/50000: 99% mana
1.0/5: 20% soul_shard
1:01.597 aoe L incinerate Fluffy_Pillow 49750.5/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
1:02.817 aoe E soul_rot Fluffy_Pillow 49002.5/50000: 98% mana
2.0/5: 40% soul_shard
1:04.123 default A cataclysm Fluffy_Pillow 49405.5/50000: 99% mana
2.1/5: 42% soul_shard
soul_rot
1:05.863 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
2.5/5: 50% soul_shard
soul_rot
1:07.604 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.8/5: 56% soul_shard
soul_rot
1:09.345 aoe I havoc enemy2 48873.0/50000: 98% mana
3.4/5: 68% soul_shard
soul_rot
1:10.650 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.6/5: 72% soul_shard
soul_rot
1:11.956 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.7/5: 94% soul_shard
backdraft, soul_rot
1:13.783 havoc Q chaos_bolt Fluffy_Pillow 49592.0/50000: 99% mana
2.9/5: 58% soul_shard
1:16.393 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:17.700 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
1:19.006 havoc Q chaos_bolt Fluffy_Pillow 49405.5/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
1:20.833 aoe F channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:23.776 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:25.517 aoe G immolate enemy3 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:26.823 aoe G immolate Fluffy_Pillow 48905.5/50000: 98% mana
1.6/5: 32% soul_shard
1:28.128 aoe G immolate enemy2 48808.0/50000: 98% mana
1.8/5: 36% soul_shard
1:29.435 aoe K conflagrate Fluffy_Pillow 48711.5/50000: 97% mana
2.0/5: 40% soul_shard
1:30.742 aoe L incinerate Fluffy_Pillow 48865.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:31.961 aoe L incinerate Fluffy_Pillow 48474.5/50000: 97% mana
3.0/5: 60% soul_shard
1:33.701 aoe J rain_of_fire Fluffy_Pillow 48344.5/50000: 97% mana
3.3/5: 66% soul_shard
1:35.008 default 9 soul_fire Fluffy_Pillow 48998.0/50000: 98% mana
0.6/5: 12% soul_shard
1:38.486 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:40.226 aoe I havoc enemy2 49372.5/50000: 99% mana
2.5/5: 50% soul_shard
1:41.532 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
2.5/5: 50% soul_shard
1:42.839 havoc Q chaos_bolt Fluffy_Pillow 49179.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:44.666 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
1:45.973 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
1:47.801 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
1:49.541 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
1:52.151 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:53.457 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
1:56.324 aoe G immolate enemy2 49935.5/50000: 100% mana
1.0/5: 20% soul_shard
1:57.630 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
1:58.935 aoe G immolate enemy3 49404.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
2:00.241 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
2:01.461 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
2.3/5: 46% soul_shard
2:02.767 aoe G immolate Fluffy_Pillow 49015.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:04.074 aoe E soul_rot Fluffy_Pillow 48918.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:05.427 aoe J rain_of_fire Fluffy_Pillow 49345.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft, soul_rot
2:06.734 aoe L incinerate Fluffy_Pillow 49998.5/50000: 100% mana
0.4/5: 8% soul_shard
backdraft, soul_rot
2:07.953 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
soul_rot
2:09.692 aoe K conflagrate Fluffy_Pillow 48871.5/50000: 98% mana
1.1/5: 22% soul_shard
soul_rot
2:11.000 default A cataclysm Fluffy_Pillow 49025.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, soul_rot
2:12.740 aoe I havoc enemy2 49395.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft, soul_rot
2:14.046 havoc Q chaos_bolt Fluffy_Pillow 49048.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:15.873 havoc R incinerate Fluffy_Pillow 49962.0/50000: 100% mana
0.6/5: 12% soul_shard
2:17.612 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
2:19.039 havoc Q chaos_bolt Fluffy_Pillow 49215.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:20.866 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:22.607 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:23.914 default 9 soul_fire Fluffy_Pillow 48906.0/50000: 98% mana
1.6/5: 32% soul_shard
2:27.390 aoe F channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.1/5: 62% soul_shard
2:30.169 aoe J rain_of_fire Fluffy_Pillow 49641.0/50000: 99% mana
3.4/5: 68% soul_shard
2:31.475 aoe G immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:32.781 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
2:34.088 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:35.309 aoe K conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
2:36.614 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:37.832 aoe G immolate enemy2 48764.5/50000: 98% mana
2.7/5: 54% soul_shard
2:39.139 aoe L incinerate Fluffy_Pillow 48668.0/50000: 97% mana
2.8/5: 56% soul_shard
2:40.880 aoe J rain_of_fire Fluffy_Pillow 48538.5/50000: 97% mana
3.3/5: 66% soul_shard
2:42.186 aoe L incinerate Fluffy_Pillow 49191.5/50000: 98% mana
0.5/5: 10% soul_shard
2:43.927 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
2:45.668 aoe I havoc enemy2 49373.0/50000: 99% mana
1.1/5: 22% soul_shard
2:46.974 havoc N conflagrate Fluffy_Pillow 49026.0/50000: 98% mana
1.2/5: 24% soul_shard
2:48.281 havoc Q chaos_bolt Fluffy_Pillow 49179.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:50.109 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:51.850 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:53.589 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.0/5: 40% soul_shard
2:54.896 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
2:56.723 havoc P immolate Fluffy_Pillow 49939.0/50000: 100% mana
1.5/5: 30% soul_shard
2:58.029 aoe F channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.7/5: 34% soul_shard
3:01.027 aoe G immolate enemy2 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
3:02.333 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
3:03.640 aoe L incinerate Fluffy_Pillow 49405.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:04.861 aoe G immolate enemy3 49003.0/50000: 98% mana
3.0/5: 60% soul_shard
3:06.166 aoe E soul_rot Fluffy_Pillow 48905.5/50000: 98% mana
3.3/5: 66% soul_shard
3:07.473 cds M summon_infernal Fluffy_Pillow 49309.0/50000: 99% mana
3.3/5: 66% soul_shard
soul_rot
3:08.779 aoe D rain_of_fire Fluffy_Pillow 48962.0/50000: 98% mana
3.8/5: 76% soul_shard
soul_rot
3:10.084 aoe K conflagrate Fluffy_Pillow 49614.5/50000: 99% mana
1.1/5: 22% soul_shard
soul_rot
3:11.391 aoe L incinerate Fluffy_Pillow 49768.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft, soul_rot
3:12.611 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
soul_rot
3:16.089 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
3:17.829 aoe I havoc enemy2 49372.5/50000: 99% mana
5.0/5: 100% soul_shard
3:19.135 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
5.0/5: 100% soul_shard
3:21.744 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:23.050 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:24.876 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:27.487 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
3:28.795 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
3:30.101 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
3:31.408 aoe F channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:34.289 aoe G immolate enemy2 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
backdraft
3:35.595 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:36.814 aoe G immolate enemy3 48861.5/50000: 98% mana
2.6/5: 52% soul_shard
3:38.120 aoe J rain_of_fire Fluffy_Pillow 48764.5/50000: 98% mana
3.0/5: 60% soul_shard
3:39.426 aoe K conflagrate Fluffy_Pillow 49417.5/50000: 99% mana
0.1/5: 2% soul_shard
3:40.731 aoe L incinerate Fluffy_Pillow 49570.0/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
3:41.951 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
3:43.692 aoe L incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.6/5: 32% soul_shard
3:45.432 aoe K conflagrate Fluffy_Pillow 48743.0/50000: 97% mana
1.9/5: 38% soul_shard
3:46.738 aoe L incinerate Fluffy_Pillow 48896.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:47.957 default A cataclysm Fluffy_Pillow 48505.5/50000: 97% mana
2.9/5: 58% soul_shard
3:49.696 aoe I havoc enemy2 48875.0/50000: 98% mana
3.2/5: 64% soul_shard
3:51.002 havoc Q chaos_bolt Fluffy_Pillow 48528.0/50000: 97% mana
3.3/5: 66% soul_shard
3:53.612 havoc N conflagrate Fluffy_Pillow 49833.0/50000: 100% mana
1.6/5: 32% soul_shard
3:54.917 havoc Q chaos_bolt Fluffy_Pillow 49985.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
3:56.745 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
3:58.051 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
3:59.792 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
4:01.533 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.4/5: 48% soul_shard
4:02.840 default 9 soul_fire Fluffy_Pillow 49026.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
4:06.318 aoe F channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
4:09.064 aoe E soul_rot Fluffy_Pillow 49625.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:10.372 aoe G immolate enemy3 49753.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft, soul_rot
4:11.677 aoe G immolate enemy2 49251.5/50000: 99% mana
5.0/5: 100% soul_shard
soul_rot
4:12.984 aoe J rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
5.0/5: 100% soul_shard
soul_rot
4:14.293 aoe K conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
2.2/5: 44% soul_shard
soul_rot
4:15.599 aoe L incinerate Fluffy_Pillow 49962.5/50000: 100% mana
2.9/5: 58% soul_shard
backdraft, soul_rot
4:16.820 aoe J rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
3.3/5: 66% soul_shard
soul_rot
4:18.127 aoe L incinerate Fluffy_Pillow 49656.5/50000: 99% mana
0.4/5: 8% soul_shard
soul_rot
4:19.867 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
4:21.608 aoe I havoc enemy2 49372.5/50000: 99% mana
1.3/5: 26% soul_shard
4:22.917 havoc N conflagrate Fluffy_Pillow 49027.0/50000: 98% mana
1.4/5: 28% soul_shard
4:24.223 havoc Q chaos_bolt Fluffy_Pillow 49180.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:26.051 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:27.791 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
4:29.098 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:30.926 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:32.665 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
1.4/5: 28% soul_shard
4:33.971 aoe F channel_demonfire Fluffy_Pillow 48904.5/50000: 98% mana
1.5/5: 30% soul_shard
4:36.806 aoe G immolate enemy2 49572.0/50000: 99% mana
2.0/5: 40% soul_shard
4:38.112 aoe K conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
4:39.417 aoe L incinerate Fluffy_Pillow 49404.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:40.636 aoe G immolate enemy3 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
4:41.944 aoe J rain_of_fire Fluffy_Pillow 48906.0/50000: 98% mana
3.2/5: 64% soul_shard
4:43.251 aoe L incinerate Fluffy_Pillow 49559.5/50000: 99% mana
0.3/5: 6% soul_shard
4:44.991 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
4:46.297 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
4:47.517 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
4:49.257 aoe L incinerate Fluffy_Pillow 48635.0/50000: 97% mana
2.1/5: 42% soul_shard
4:50.999 aoe L incinerate Fluffy_Pillow 48506.0/50000: 97% mana
2.5/5: 50% soul_shard
4:52.738 default A cataclysm Fluffy_Pillow 48375.5/50000: 97% mana
2.9/5: 58% soul_shard
4:54.479 default 9 soul_fire Fluffy_Pillow 48746.0/50000: 97% mana
3.3/5: 66% soul_shard
4:57.958 aoe F channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
4.7/5: 94% soul_shard
5:00.769 aoe I havoc enemy2 49658.5/50000: 99% mana
5.0/5: 100% soul_shard
5:02.073 havoc Q chaos_bolt Fluffy_Pillow 49310.5/50000: 99% mana
5.0/5: 100% soul_shard
5:04.682 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:05.987 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:07.815 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
5:09.119 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
5:10.427 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
5:12.257 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
5:13.565 aoe E soul_rot Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
5:14.870 aoe G immolate enemy3 49751.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft, soul_rot

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="NF_SoulEater"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=night_fae
soulbind=220:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necro_AshenRemains : 9631 dps, 5330 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9630.5 9630.5 16.3 / 0.169% 770.5 / 8.0% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
406.2 402.6 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necro_AshenRemains 9631
Cataclysm 772 8.0% 9.6 32.52sec 23991 14124 Direct 28.7 6701 13401 8005 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 28.71 0.00 0.00 1.6987 0.0000 229586.26 229586.26 0.00% 14124.04 14124.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 23.15 15 33 6700.74 6141 7261 6701.55 6471 6918 155150 155150 0.00%
crit 19.35% 5.56 0 13 13401.07 12286 14521 13373.42 0 14322 74436 74436 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.64
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1016) 0.0% (10.6%) 12.0 25.41sec 25151 9341

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.01 0.00 179.24 0.00 2.6927 0.1634 0.00 0.00 0.00% 9340.61 9340.61

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.02
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1016 10.6% 0.0 0.00sec 0 0 Direct 537.7 472 940 562 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 537.71 0.00 0.00 0.0000 0.0000 302056.69 302056.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 434.59 319 572 471.89 263 976 472.26 445 503 205081 205081 0.00%
crit 19.18% 103.13 64 153 940.24 525 1952 941.26 819 1086 96976 96976 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1352 (1819) 14.0% (18.9%) 22.3 12.82sec 24174 12228 Direct 44.4 (88.4) 0 9030 9030 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.33 44.44 0.00 0.00 1.9770 0.0000 401343.15 401343.15 0.00% 12227.62 12227.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.44 32 58 9030.29 5861 12241 9030.22 8860 9255 401343 401343 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.43
  • if_expr:cast_time<havoc_remains
    Internal Combustion 467 4.8% 44.0 12.83sec 3148 0 Direct 44.0 2632 5277 3147 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.99 43.99 0.00 0.00 0.0000 0.0000 138494.04 138494.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 35.40 23 50 2631.59 1 3715 2633.24 2435 2814 93145 93145 0.00%
crit 19.54% 8.59 1 16 5276.77 2 7425 5283.69 2162 6398 45349 45349 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 817 8.5% 36.7 7.95sec 6617 5297 Direct 56.5 3611 7196 4296 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.70 56.52 0.00 0.00 1.2493 0.0000 242834.77 242834.77 0.00% 5296.86 5296.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 45.72 32 62 3611.45 2047 5042 3611.37 3398 3871 165098 165098 0.00%
crit 19.11% 10.80 2 22 7196.35 4095 10084 7192.78 5251 8886 77736 77736 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.92
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.77
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (100) 0.0% (1.0%) 5.0 60.49sec 5988 2885

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 2.0752 0.0000 0.00 0.00 0.00% 2885.44 2885.44

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.03
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 100 1.0% 0.0 0.00sec 0 0 Direct 19.9 1259 2513 1506 19.7%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.86 0.00 0.00 0.0000 0.0000 29910.48 29910.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.28% 15.94 8 28 1258.87 899 1674 1255.77 1148 1375 20068 20068 0.00%
crit 19.72% 3.92 0 11 2512.96 1800 3348 2465.55 0 3238 9843 9843 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1610 16.7% 26.9 10.62sec 17799 14105 Direct 34.4 1536 3070 1833 19.3%
Periodic 343.6 1013 2027 1210 19.4% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.91 34.43 343.57 343.57 1.2619 2.4816 478976.17 478976.17 0.00% 540.25 14104.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 27.78 17 40 1536.49 819 2017 1537.48 1420 1683 42695 42695 0.00%
crit 19.29% 6.64 0 15 3070.12 1642 4034 3067.04 0 4003 20378 20378 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 276.80 212 353 1013.37 0 1261 1013.56 995 1034 280511 280511 0.00%
crit 19.44% 66.78 40 97 2027.37 10 2521 2027.92 1903 2129 135393 135393 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.26
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.74
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 809 8.4% 40.5 6.78sec 5956 4053 Direct 49.9 (49.9) 4056 8155 4839 19.1% (19.1%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.51 49.88 0.00 0.00 1.4696 0.0000 241257.61 241257.61 0.00% 4052.71 4052.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.88% 40.34 22 61 4055.92 1327 8869 4067.53 3406 5267 163524 163524 0.00%
crit 19.12% 9.54 0 23 8155.36 2637 17585 8158.82 0 14570 77734 77734 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.01
    havoc
    [R]:9.74
  • if_expr:cast_time<havoc_remains
Rain of Fire 865 9.0% 16.4 17.48sec 15644 12506 Periodic 389.8 553 1106 660 19.3% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.44 0.00 0.00 389.81 1.2510 0.0000 257144.38 257144.38 0.00% 12506.41 12506.41
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 314.53 190 451 552.94 507 599 552.91 546 561 173910 173910 0.00%
crit 19.31% 75.27 41 108 1105.75 1013 1198 1105.73 1080 1126 83234 83234 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.06
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.39
Soul Fire 509 5.3% 5.5 49.51sec 27253 7837 Direct 7.5 17047 34121 20285 18.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.46 0.00 0.00 3.4775 0.0000 151169.91 151169.91 0.00% 7837.10 7837.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.10% 6.05 1 10 17046.66 8725 21176 17078.59 14170 20806 103126 103126 0.00%
crit 18.90% 1.41 0 5 34121.04 17347 42352 27510.98 0 42349 48044 48044 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.68
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.95
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.78sec 12025 10402 Direct 6.0 3348 6696 3999 19.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24049.14 24049.14 0.00% 10401.88 10401.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.29% 4.82 1 6 3348.13 3348 3348 3348.13 3348 3348 16128 16128 0.00%
crit 19.71% 1.18 0 5 6696.27 6696 6696 4854.25 0 6696 7921 7921 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3507 / 717
Immolation 3241 6.8% 39.0 5.50sec 4987 0 Direct 117.0 1395 2790 1662 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194492.96 194492.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 94.58 80 108 1395.06 1395 1395 1395.06 1395 1395 131950 131950 0.00%
crit 19.16% 22.42 9 37 2790.11 2790 2790 2790.11 2790 2790 62543 62543 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.26sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15940.99 22770.12 29.99% 270.63 270.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 33.03 25 40 325.55 326 326 325.55 326 326 10754 15361 29.99%
crit 19.43% 7.97 1 16 651.10 651 651 651.10 651 651 5187 7409 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 92.6 3.21sec 1651 1134 Direct 91.9 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152860.24 152860.24 0.00% 1134.05 1134.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 74.17 55 97 1395.06 1395 1395 1395.06 1395 1395 103478 103478 0.00%
crit 19.26% 17.70 7 33 2790.11 2790 2790 2790.11 2790 2790 49382 49382 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Necro_AshenRemains
Havoc 9.5 32.33sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.51 0.00 0.00 0.00 1.2434 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.52
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.2sec 52.46% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.46%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 5.0 0.0 60.7sec 60.7sec 10.0sec 16.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 73.5s
  • trigger_min/max:47.2s / 73.5s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 36.8s

Stack Uptimes

  • decimating_bolt_1:6.59%
  • decimating_bolt_2:5.91%
  • decimating_bolt_3:4.02%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necro_AshenRemains_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 183.5s
  • trigger_min/max:180.0s / 183.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necro_AshenRemains_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 183.5s
  • trigger_min/max:180.0s / 183.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.06% 8.58% 14.78% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necro_AshenRemains
soul_fire Soul Shard 6.56 7.27 7.80% 1.11 0.23 3.12%
immolate Soul Shard 343.67 33.08 35.46% 0.10 1.29 3.76%
incinerate Soul Shard 40.54 10.04 10.77% 0.25 0.00 0.00%
conflagrate Soul Shard 36.69 28.25 30.28% 0.77 0.00 0.00%
mana_regen Mana 661.83 119870.15 100.00% 181.12 28645.21 19.29%
immolate_crits Soul Shard 33.38 3.21 3.44% 0.10 0.13 3.87%
incinerate_crits Soul Shard 9.53 0.95 1.02% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.47 11.22% 0.09 1.53 12.76%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.65 406.23 28668.4 48933.8 46799.5 50000.0
Soul Shard 4.0 0.31 0.32 3.2 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necro_AshenRemains
cataclysm Mana 9.6 4790.2 500.0 500.6 47.9
channel_demonfire Mana 12.0 9011.8 750.0 750.4 33.5
chaos_bolt Soul Shard 22.3 44.6 2.0 2.0 12102.4
conflagrate Mana 36.7 18344.6 500.0 499.9 13.2
decimating_bolt Mana 5.0 10006.3 2000.0 2003.2 3.0
havoc Mana 9.5 9517.4 1000.0 1000.5 0.0
immolate Mana 26.9 20170.7 750.0 749.5 23.7
incinerate Mana 40.5 40539.4 1000.0 1000.8 6.0
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5210.8
soul_fire Mana 6.6 6558.4 1000.0 1182.3 23.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Necro_AshenRemains Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Necro_AshenRemains Damage Per Second
Count 618
Mean 9630.54
Minimum 9115.19
Maximum 10254.09
Spread ( max - min ) 1138.90
Range [ ( max - min ) / 2 * 100% ] 5.91%
Standard Deviation 206.6326
5th Percentile 9307.85
95th Percentile 9993.94
( 95th Percentile - 5th Percentile ) 686.09
Mean Distribution
Standard Deviation 8.3120
95.00% Confidence Interval ( 9614.25 - 9646.83 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1769
0.1 Scale Factor Error with Delta=300 365
0.05 Scale Factor Error with Delta=300 1458
0.01 Scale Factor Error with Delta=300 36449
Priority Target DPS
Necro_AshenRemains Priority Target Damage Per Second
Count 618
Mean 5329.62
Minimum 4990.37
Maximum 5678.72
Spread ( max - min ) 688.35
Range [ ( max - min ) / 2 * 100% ] 6.46%
Standard Deviation 123.3906
5th Percentile 5142.44
95th Percentile 5545.31
( 95th Percentile - 5th Percentile ) 402.86
Mean Distribution
Standard Deviation 4.9635
95.00% Confidence Interval ( 5319.89 - 5339.35 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2060
0.1 Scale Factor Error with Delta=300 130
0.05 Scale Factor Error with Delta=300 520
0.01 Scale Factor Error with Delta=300 12998
DPS(e)
Necro_AshenRemains Damage Per Second (Effective)
Count 618
Mean 9630.54
Minimum 9115.19
Maximum 10254.09
Spread ( max - min ) 1138.90
Range [ ( max - min ) / 2 * 100% ] 5.91%
Damage
Necro_AshenRemains Damage
Count 618
Mean 2496822.60
Minimum 2034412.07
Maximum 3041100.10
Spread ( max - min ) 1006688.03
Range [ ( max - min ) / 2 * 100% ] 20.16%
DTPS
Necro_AshenRemains Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necro_AshenRemains Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necro_AshenRemains Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necro_AshenRemains Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necro_AshenRemains Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necro_AshenRemains Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necro_AshenRemainsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necro_AshenRemains Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.68 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.64 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.06 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.02 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.26 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.52 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.39 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.03 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.92 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.01 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.77 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.95 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.74 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.43 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.74 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFDFJKLKDLLALEHNQQNPOILKFIELKLLALHNQQRNPEIJFKLLLL9AHQNQNQPNEILLFFFKLLIKAHRRNQQP9EJFKILFKLLAHNQQRNPEILKLFMLDKL9AHQNQQNPDEFJFKLILKLLAHQNQPRN9EIFKFLLIKLAHRQRNQPEJKLFIKLLL9AEHQNQNPQNLLF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.923 cds M summon_infernal Fluffy_Pillow 49711.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.929 aoe H havoc enemy2 49214.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.935 havoc Q chaos_bolt Fluffy_Pillow 48717.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.943 havoc N conflagrate Fluffy_Pillow 49721.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.948 havoc Q chaos_bolt Fluffy_Pillow 49724.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.354 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.360 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.367 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.774 havoc N conflagrate Fluffy_Pillow 49956.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.780 havoc Q chaos_bolt Fluffy_Pillow 49959.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.186 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.193 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.198 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.638 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:21.645 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.652 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:23.660 aoe F immolate enemy3 49510.0/50000: 99% mana
0.4/5: 8% soul_shard
bloodlust, backdraft
0:24.667 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
bloodlust, backdraft
0:26.342 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
1.3/5: 26% soul_shard
bloodlust
0:27.349 aoe L incinerate Fluffy_Pillow 48006.0/50000: 96% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:28.288 aoe K conflagrate Fluffy_Pillow 47475.5/50000: 95% mana
2.7/5: 54% soul_shard
bloodlust, decimating_bolt(2)
0:29.295 aoe D rain_of_fire Fluffy_Pillow 47479.0/50000: 95% mana
3.6/5: 72% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:30.302 aoe L incinerate Fluffy_Pillow 47982.5/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.242 aoe L incinerate Fluffy_Pillow 47452.5/50000: 95% mana
1.6/5: 32% soul_shard
bloodlust, decimating_bolt
0:32.582 default A cataclysm Fluffy_Pillow 47122.5/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:33.923 aoe L incinerate Fluffy_Pillow 47293.0/50000: 95% mana
2.8/5: 56% soul_shard
bloodlust
0:35.264 aoe E channel_demonfire Fluffy_Pillow 46963.5/50000: 94% mana
3.2/5: 64% soul_shard
bloodlust
0:37.427 aoe H havoc enemy2 47295.0/50000: 95% mana
3.6/5: 72% soul_shard
bloodlust
0:38.433 havoc N conflagrate Fluffy_Pillow 46798.0/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust
0:39.439 havoc Q chaos_bolt Fluffy_Pillow 46801.0/50000: 94% mana
4.9/5: 98% soul_shard
bloodlust, backdraft
0:40.845 havoc Q chaos_bolt Fluffy_Pillow 47504.0/50000: 95% mana
3.0/5: 60% soul_shard
bloodlust
0:42.853 havoc N conflagrate Fluffy_Pillow 48508.0/50000: 97% mana
1.3/5: 26% soul_shard
0:44.159 havoc P immolate Fluffy_Pillow 48661.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
0:45.462 havoc O soul_fire Fluffy_Pillow 48562.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
0:48.941 aoe I rain_of_fire Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:50.247 aoe L incinerate Fluffy_Pillow 49656.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:51.466 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:52.773 aoe F immolate enemy3 49155.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
0:54.079 aoe I rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
0:55.386 aoe E channel_demonfire Fluffy_Pillow 49712.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
0:58.216 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
0:59.436 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:00.742 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:01.962 aoe L incinerate Fluffy_Pillow 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
1:03.703 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
2.6/5: 52% soul_shard
1:05.657 aoe L incinerate Fluffy_Pillow 49113.0/50000: 98% mana
2.7/5: 54% soul_shard
1:07.398 aoe H havoc enemy2 48983.5/50000: 98% mana
3.1/5: 62% soul_shard
1:08.735 havoc N conflagrate Fluffy_Pillow 48652.0/50000: 97% mana
3.2/5: 64% soul_shard
1:10.042 havoc Q chaos_bolt Fluffy_Pillow 48805.5/50000: 98% mana
4.4/5: 88% soul_shard
backdraft
1:11.870 havoc Q chaos_bolt Fluffy_Pillow 49719.5/50000: 99% mana
2.7/5: 54% soul_shard
1:14.481 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:16.221 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
1:17.525 havoc P immolate Fluffy_Pillow 49154.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:18.831 aoe E channel_demonfire Fluffy_Pillow 49057.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:21.636 aoe I rain_of_fire Fluffy_Pillow 49709.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
1:22.942 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:25.116 aoe F immolate enemy3 48001.5/50000: 96% mana
0.9/5: 18% soul_shard
backdraft
1:26.423 aoe K conflagrate Fluffy_Pillow 47905.0/50000: 96% mana
1.0/5: 20% soul_shard
1:27.731 aoe L incinerate Fluffy_Pillow 48059.0/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(3)
1:28.951 aoe L incinerate Fluffy_Pillow 47669.0/50000: 95% mana
2.0/5: 40% soul_shard
decimating_bolt(2)
1:30.693 aoe L incinerate Fluffy_Pillow 47540.0/50000: 95% mana
2.4/5: 48% soul_shard
decimating_bolt
1:32.433 aoe L incinerate Fluffy_Pillow 47410.0/50000: 95% mana
2.9/5: 58% soul_shard
1:34.175 default 9 soul_fire Fluffy_Pillow 47281.0/50000: 95% mana
3.2/5: 64% soul_shard
1:37.653 default A cataclysm Fluffy_Pillow 48020.0/50000: 96% mana
4.9/5: 98% soul_shard
1:39.394 aoe H havoc enemy2 48390.5/50000: 97% mana
4.9/5: 98% soul_shard
1:40.702 havoc Q chaos_bolt Fluffy_Pillow 48044.5/50000: 96% mana
5.0/5: 100% soul_shard
1:43.312 havoc N conflagrate Fluffy_Pillow 49349.5/50000: 99% mana
3.0/5: 60% soul_shard
1:44.619 havoc Q chaos_bolt Fluffy_Pillow 49503.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
1:46.447 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:47.754 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:49.582 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
1:50.889 havoc N conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.8/5: 36% soul_shard
1:52.197 aoe E channel_demonfire Fluffy_Pillow 49406.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
1:55.124 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
1:56.429 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
1:57.649 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.7/5: 14% soul_shard
1:59.390 aoe F immolate enemy3 48873.0/50000: 98% mana
1.1/5: 22% soul_shard
2:00.696 aoe F immolate enemy2 48776.0/50000: 98% mana
1.3/5: 26% soul_shard
2:02.003 aoe F immolate Fluffy_Pillow 48679.5/50000: 97% mana
1.5/5: 30% soul_shard
2:03.310 aoe K conflagrate Fluffy_Pillow 48583.0/50000: 97% mana
1.6/5: 32% soul_shard
2:04.617 aoe L incinerate Fluffy_Pillow 48736.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
2:05.837 aoe L incinerate Fluffy_Pillow 48346.5/50000: 97% mana
2.6/5: 52% soul_shard
2:07.577 aoe I rain_of_fire Fluffy_Pillow 48216.5/50000: 96% mana
3.0/5: 60% soul_shard
2:08.883 aoe K conflagrate Fluffy_Pillow 48869.5/50000: 98% mana
0.2/5: 4% soul_shard
2:10.191 default A cataclysm Fluffy_Pillow 49023.5/50000: 98% mana
0.8/5: 16% soul_shard
backdraft
2:11.932 aoe H havoc enemy2 49394.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:13.241 havoc R incinerate Fluffy_Pillow 49048.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
2:14.461 havoc R incinerate Fluffy_Pillow 48658.5/50000: 97% mana
1.9/5: 38% soul_shard
2:16.202 havoc N conflagrate Fluffy_Pillow 48529.0/50000: 97% mana
2.5/5: 50% soul_shard
2:17.717 havoc Q chaos_bolt Fluffy_Pillow 48786.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
2:19.543 havoc Q chaos_bolt Fluffy_Pillow 49699.5/50000: 99% mana
2.1/5: 42% soul_shard
2:22.154 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.460 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.5/5: 10% soul_shard
2:26.937 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
2:29.726 aoe J decimating_bolt Fluffy_Pillow 49646.5/50000: 99% mana
2.4/5: 48% soul_shard
2:31.900 aoe F immolate enemy3 48001.5/50000: 96% mana
2.6/5: 52% soul_shard
2:33.207 aoe K conflagrate Fluffy_Pillow 47905.0/50000: 96% mana
2.8/5: 56% soul_shard
2:34.512 aoe I rain_of_fire Fluffy_Pillow 48057.5/50000: 96% mana
3.4/5: 68% soul_shard
backdraft, decimating_bolt(3)
2:35.817 aoe L incinerate Fluffy_Pillow 48710.0/50000: 97% mana
0.6/5: 12% soul_shard
backdraft, decimating_bolt(3)
2:37.037 aoe F immolate enemy2 48320.0/50000: 97% mana
0.9/5: 18% soul_shard
decimating_bolt(2)
2:38.344 aoe K conflagrate Fluffy_Pillow 48223.5/50000: 96% mana
1.1/5: 22% soul_shard
decimating_bolt(2)
2:39.650 aoe L incinerate Fluffy_Pillow 48376.5/50000: 97% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(2)
2:40.871 aoe L incinerate Fluffy_Pillow 47987.0/50000: 96% mana
2.1/5: 42% soul_shard
decimating_bolt
2:42.613 default A cataclysm Fluffy_Pillow 47858.0/50000: 96% mana
2.5/5: 50% soul_shard
2:44.355 aoe H havoc enemy2 48229.0/50000: 96% mana
2.7/5: 54% soul_shard
2:45.661 havoc N conflagrate Fluffy_Pillow 47882.0/50000: 96% mana
3.0/5: 60% soul_shard
2:46.966 havoc Q chaos_bolt Fluffy_Pillow 48034.5/50000: 96% mana
4.0/5: 80% soul_shard
backdraft
2:48.795 havoc Q chaos_bolt Fluffy_Pillow 48949.0/50000: 98% mana
2.5/5: 50% soul_shard
2:51.405 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
2:53.145 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:54.451 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:55.755 aoe E channel_demonfire Fluffy_Pillow 49057.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:58.631 aoe I rain_of_fire Fluffy_Pillow 49745.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:59.937 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
3:01.156 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
3:02.462 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
3:03.682 aoe F immolate enemy3 48765.0/50000: 98% mana
1.7/5: 34% soul_shard
3:04.990 cds M summon_infernal Fluffy_Pillow 48669.0/50000: 97% mana
1.8/5: 36% soul_shard
3:06.295 aoe L incinerate Fluffy_Pillow 48321.5/50000: 97% mana
2.2/5: 44% soul_shard
3:08.036 aoe D rain_of_fire Fluffy_Pillow 48192.0/50000: 96% mana
3.0/5: 60% soul_shard
3:09.344 aoe K conflagrate Fluffy_Pillow 48846.0/50000: 98% mana
0.5/5: 10% soul_shard
3:10.650 aoe L incinerate Fluffy_Pillow 48999.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:11.869 default 9 soul_fire Fluffy_Pillow 48608.5/50000: 97% mana
2.1/5: 42% soul_shard
3:15.409 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
4.2/5: 84% soul_shard
3:17.150 aoe H havoc enemy2 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
3:18.454 havoc Q chaos_bolt Fluffy_Pillow 49024.0/50000: 98% mana
5.0/5: 100% soul_shard
3:21.064 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:22.372 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:24.199 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:26.808 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
3:28.115 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
3:29.421 aoe D rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
3:30.728 aoe E channel_demonfire Fluffy_Pillow 49905.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:33.547 aoe F immolate enemy2 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:34.854 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:37.031 aoe F immolate enemy3 48003.0/50000: 96% mana
2.2/5: 44% soul_shard
3:38.338 aoe K conflagrate Fluffy_Pillow 47906.5/50000: 96% mana
2.5/5: 50% soul_shard
3:39.644 aoe L incinerate Fluffy_Pillow 48059.5/50000: 96% mana
3.0/5: 60% soul_shard
backdraft, decimating_bolt(3)
3:40.863 aoe I rain_of_fire Fluffy_Pillow 47669.0/50000: 95% mana
3.5/5: 70% soul_shard
decimating_bolt(2)
3:42.169 aoe L incinerate Fluffy_Pillow 48322.0/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt(2)
3:43.910 aoe K conflagrate Fluffy_Pillow 48192.5/50000: 96% mana
1.1/5: 22% soul_shard
decimating_bolt
3:45.218 aoe L incinerate Fluffy_Pillow 48346.5/50000: 97% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt
3:46.435 aoe L incinerate Fluffy_Pillow 47955.0/50000: 96% mana
2.1/5: 42% soul_shard
3:48.174 default A cataclysm Fluffy_Pillow 47824.5/50000: 96% mana
2.6/5: 52% soul_shard
3:49.914 aoe H havoc enemy2 48194.5/50000: 96% mana
2.6/5: 52% soul_shard
3:51.220 havoc Q chaos_bolt Fluffy_Pillow 47847.5/50000: 96% mana
2.8/5: 56% soul_shard
3:53.830 havoc N conflagrate Fluffy_Pillow 49152.5/50000: 98% mana
1.1/5: 22% soul_shard
3:55.138 havoc Q chaos_bolt Fluffy_Pillow 49306.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:56.968 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
3:58.276 havoc R incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
4:00.017 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:01.504 default 9 soul_fire Fluffy_Pillow 49246.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:04.983 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
4:07.839 aoe I rain_of_fire Fluffy_Pillow 49681.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
4:09.146 aoe F immolate enemy3 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
backdraft
4:10.454 aoe K conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.5/5: 30% soul_shard
4:11.761 aoe F immolate enemy2 49406.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
4:13.069 aoe L incinerate Fluffy_Pillow 49253.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
4:14.290 aoe L incinerate Fluffy_Pillow 48863.5/50000: 98% mana
2.8/5: 56% soul_shard
4:16.031 aoe I rain_of_fire Fluffy_Pillow 48734.0/50000: 97% mana
3.1/5: 62% soul_shard
4:17.338 aoe K conflagrate Fluffy_Pillow 49387.5/50000: 99% mana
0.4/5: 8% soul_shard
4:18.803 aoe L incinerate Fluffy_Pillow 49620.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:20.022 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
4:21.762 aoe H havoc enemy2 49372.0/50000: 99% mana
1.8/5: 36% soul_shard
4:23.068 havoc R incinerate Fluffy_Pillow 49025.0/50000: 98% mana
1.8/5: 36% soul_shard
4:24.809 havoc Q chaos_bolt Fluffy_Pillow 48895.5/50000: 98% mana
2.5/5: 50% soul_shard
4:27.419 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
4:29.159 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
4:30.465 havoc Q chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:32.292 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:33.599 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
1.0/5: 20% soul_shard
4:36.436 aoe J decimating_bolt Fluffy_Pillow 49921.0/50000: 100% mana
1.4/5: 28% soul_shard
4:38.613 aoe K conflagrate Fluffy_Pillow 48003.0/50000: 96% mana
1.8/5: 36% soul_shard
4:39.920 aoe L incinerate Fluffy_Pillow 48156.5/50000: 96% mana
2.5/5: 50% soul_shard
backdraft
4:41.140 aoe F immolate enemy3 47766.5/50000: 96% mana
2.9/5: 58% soul_shard
decimating_bolt(2)
4:42.447 aoe I rain_of_fire Fluffy_Pillow 47670.0/50000: 95% mana
3.1/5: 62% soul_shard
decimating_bolt(2)
4:43.753 aoe K conflagrate Fluffy_Pillow 48323.0/50000: 97% mana
0.2/5: 4% soul_shard
decimating_bolt(2)
4:45.059 aoe L incinerate Fluffy_Pillow 48476.0/50000: 97% mana
0.9/5: 18% soul_shard
backdraft, decimating_bolt(2)
4:46.279 aoe L incinerate Fluffy_Pillow 48086.0/50000: 96% mana
1.2/5: 24% soul_shard
decimating_bolt
4:48.017 aoe L incinerate Fluffy_Pillow 47955.0/50000: 96% mana
1.8/5: 36% soul_shard
4:49.756 default 9 soul_fire Fluffy_Pillow 47824.5/50000: 96% mana
2.0/5: 40% soul_shard
4:53.455 default A cataclysm Fluffy_Pillow 48674.0/50000: 97% mana
3.6/5: 72% soul_shard
4:55.194 aoe E channel_demonfire Fluffy_Pillow 49043.5/50000: 98% mana
3.6/5: 72% soul_shard
4:58.232 aoe H havoc enemy2 49812.5/50000: 100% mana
4.0/5: 80% soul_shard
4:59.538 havoc Q chaos_bolt Fluffy_Pillow 49465.5/50000: 99% mana
4.0/5: 80% soul_shard
5:02.147 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
5:03.453 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
5:05.282 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
5:06.589 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
5:07.897 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
5:09.725 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
5:11.032 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
5:12.251 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
5:13.991 aoe F immolate enemy3 48872.0/50000: 98% mana
3.3/5: 66% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necro_AshenRemains"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=211:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necro_CombustingEngine : 9649 dps, 5326 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9648.9 9648.9 16.9 / 0.176% 811.0 / 8.4% 20.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
405.9 402.6 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necro_CombustingEngine 9649
Cataclysm 770 8.0% 9.6 32.49sec 23953 14102 Direct 28.7 6701 13399 7981 19.1%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.56 28.68 0.00 0.00 1.6987 0.0000 229023.72 229023.72 0.00% 14101.58 14101.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 23.19 13 32 6701.19 6142 7261 6701.43 6497 6944 155449 155449 0.00%
crit 19.14% 5.49 0 12 13399.17 12283 14521 13380.15 0 14510 73575 73575 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.64
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1015) 0.0% (10.5%) 12.0 25.91sec 25184 9356

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.99 0.00 178.97 0.00 2.6918 0.1634 0.00 0.00 0.00% 9356.12 9356.12

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.99
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1015 10.5% 0.0 0.00sec 0 0 Direct 536.9 472 942 562 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.90 0.00 0.00 0.0000 0.0000 301884.73 301884.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 433.61 316 566 471.77 263 976 472.12 435 500 204569 204569 0.00%
crit 19.24% 103.30 62 156 941.71 525 1952 943.21 811 1095 97315 97315 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1275 (1801) 13.2% (18.7%) 22.3 12.99sec 23937 12109 Direct 44.4 (88.5) 0 8520 8520 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.35 44.45 0.00 0.00 1.9769 0.0000 378738.04 378738.04 0.00% 12108.81 12108.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.45 32 60 8520.40 5861 11548 8521.09 8307 8715 378738 378738 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.45
  • if_expr:cast_time<havoc_remains
    Internal Combustion 526 5.5% 44.0 12.95sec 3549 0 Direct 44.0 2976 5950 3549 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 156168.59 156168.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 35.53 23 49 2975.96 1 4607 2979.53 2703 3306 105694 105694 0.00%
crit 19.27% 8.48 1 17 5949.52 2 9211 5962.56 4119 7221 50474 50474 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 815 8.4% 36.7 7.93sec 6598 5281 Direct 56.5 3610 7171 4284 18.9%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.70 56.53 0.00 0.00 1.2493 0.0000 242115.84 242115.84 0.00% 5281.18 5281.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.06% 45.82 32 62 3610.36 2047 5042 3611.47 3337 3837 165459 165459 0.00%
crit 18.94% 10.70 2 21 7171.06 4095 10083 7172.57 4683 9217 76657 76657 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.88
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.81
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (99) 0.0% (1.0%) 5.0 61.11sec 5964 2875

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.96 0.00 0.00 0.00 2.0746 0.0000 0.00 0.00 0.00% 2875.14 2875.14

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.01
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 99 1.0% 0.0 0.00sec 0 0 Direct 19.8 1257 2512 1499 19.1%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.77 0.00 0.00 0.0000 0.0000 29599.54 29599.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 15.99 9 26 1257.49 900 1674 1254.66 1147 1363 20103 20103 0.00%
crit 19.13% 3.78 0 10 2511.91 1799 3347 2494.36 0 3334 9497 9497 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1694 17.6% 26.9 10.76sec 18714 14830 Direct 34.4 1537 3078 1828 18.9%
Periodic 343.4 1076 2152 1284 19.3% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.91 34.37 343.39 343.39 1.2619 2.4822 503648.95 503648.95 0.00% 568.24 14830.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.14% 27.89 17 41 1537.48 822 2017 1537.75 1437 1673 42872 42872 0.00%
crit 18.86% 6.48 1 14 3077.68 1644 4033 3080.56 2117 3829 19952 19952 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 277.01 211 349 1075.68 2 1714 1075.78 1047 1101 297973 297973 0.00%
crit 19.33% 66.38 41 96 2152.09 1 3403 2152.91 2000 2316 142851 142851 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.28
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.76
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 764 7.9% 40.5 6.64sec 5613 3816 Direct 50.0 (50.0) 3816 7680 4550 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.53 50.04 0.00 0.00 1.4707 0.0000 227456.24 227456.24 0.00% 3816.32 3816.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 40.53 26 58 3815.58 1312 8349 3817.35 3120 4874 154457 154457 0.00%
crit 19.00% 9.51 2 24 7680.42 2627 16622 7739.17 4196 13727 72999 72999 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.92
    havoc
    [R]:9.85
  • if_expr:cast_time<havoc_remains
Rain of Fire 866 9.0% 16.4 17.17sec 15636 12499 Periodic 389.7 553 1106 660 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.43 0.00 0.00 389.67 1.2510 0.0000 256912.51 256912.51 0.00% 12499.39 12499.39
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.76% 314.70 206 452 552.92 507 599 552.91 545 560 173998 173998 0.00%
crit 19.24% 74.98 39 113 1105.89 1013 1198 1105.95 1081 1125 82914 82914 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.06
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.36
Soul Fire 511 5.3% 5.5 49.42sec 27400 7879 Direct 7.5 17088 33979 20362 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.46 0.00 0.00 3.4775 0.0000 151984.24 151984.24 0.00% 7879.32 7879.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 6.01 3 10 17087.62 8616 21176 17097.60 14114 19565 102804 102804 0.00%
crit 19.41% 1.45 0 5 33979.44 17365 42315 26722.67 0 42283 49180 49180 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.68
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.96
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.65sec 12090 10458 Direct 6.0 3348 6696 4028 20.4%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24179.17 24179.17 0.00% 10458.12 10458.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.64% 4.78 1 6 3348.13 3348 3348 3348.13 3348 3348 15998 15998 0.00%
crit 20.36% 1.22 0 5 6696.27 6696 6696 5103.47 0 6696 8181 8181 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3517 / 719
Immolation 3251 6.8% 39.0 5.50sec 5002 0 Direct 117.0 1395 2790 1667 19.5%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 195082.14 195082.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 94.16 79 110 1395.06 1395 1395 1395.06 1395 1395 131361 131361 0.00%
crit 19.52% 22.84 7 38 2790.11 2790 2790 2790.11 2790 2790 63721 63721 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15918.34 22737.76 29.99% 270.24 270.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 33.10 26 40 325.55 326 326 325.55 326 326 10777 15394 29.99%
crit 19.26% 7.90 1 15 651.10 651 651 651.10 651 651 5141 7344 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.3% 92.6 3.21sec 1649 1133 Direct 91.9 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152722.54 152722.54 0.00% 1133.03 1133.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 74.27 54 94 1395.06 1395 1395 1395.06 1395 1395 103616 103616 0.00%
crit 19.16% 17.60 7 33 2790.11 2790 2790 2790.11 2790 2790 49107 49107 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Necro_CombustingEngine
Havoc 9.5 32.25sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.49 0.00 0.00 0.00 1.2433 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.50
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.3sec 52.58% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.58%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 4.9 0.0 60.9sec 60.9sec 10.0sec 16.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 74.9s
  • trigger_min/max:47.2s / 74.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.9s

Stack Uptimes

  • decimating_bolt_1:6.57%
  • decimating_bolt_2:5.88%
  • decimating_bolt_3:4.04%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necro_CombustingEngine_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.6s
  • trigger_min/max:180.0s / 184.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necro_CombustingEngine_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.6s
  • trigger_min/max:180.0s / 184.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.07% 8.75% 14.42% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necro_CombustingEngine
soul_fire Soul Shard 6.56 7.27 7.80% 1.11 0.23 3.07%
immolate Soul Shard 343.48 33.01 35.41% 0.10 1.34 3.89%
incinerate Soul Shard 40.53 10.06 10.79% 0.25 0.00 0.00%
conflagrate Soul Shard 36.69 28.26 30.31% 0.77 0.00 0.00%
mana_regen Mana 661.53 119828.44 100.00% 181.14 28701.33 19.32%
immolate_crits Soul Shard 33.26 3.20 3.43% 0.10 0.13 3.88%
incinerate_crits Soul Shard 9.51 0.95 1.02% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.47 11.23% 0.09 1.53 12.74%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.56 405.94 28711.0 48992.0 46778.5 50000.0
Soul Shard 4.0 0.31 0.32 3.2 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Necro_CombustingEngine
cataclysm Mana 9.6 4786.3 500.0 500.6 47.9
channel_demonfire Mana 12.0 8995.3 750.0 750.4 33.6
chaos_bolt Soul Shard 22.3 44.7 2.0 2.0 11971.6
conflagrate Mana 36.7 18345.4 500.0 499.9 13.2
decimating_bolt Mana 5.0 9940.1 2000.0 2002.9 3.0
havoc Mana 9.5 9496.8 1000.0 1000.5 0.0
immolate Mana 26.9 20192.0 750.0 750.3 24.9
incinerate Mana 40.5 40528.4 1000.0 1000.1 5.6
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5214.1
soul_fire Mana 6.6 6555.2 1000.0 1181.8 23.2
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Necro_CombustingEngine Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Necro_CombustingEngine Damage Per Second
Count 618
Mean 9648.88
Minimum 9016.96
Maximum 10295.78
Spread ( max - min ) 1278.81
Range [ ( max - min ) / 2 * 100% ] 6.63%
Standard Deviation 214.8444
5th Percentile 9301.75
95th Percentile 10007.16
( 95th Percentile - 5th Percentile ) 705.40
Mean Distribution
Standard Deviation 8.6423
95.00% Confidence Interval ( 9631.94 - 9665.82 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1905
0.1 Scale Factor Error with Delta=300 395
0.05 Scale Factor Error with Delta=300 1577
0.01 Scale Factor Error with Delta=300 39404
Priority Target DPS
Necro_CombustingEngine Priority Target Damage Per Second
Count 618
Mean 5326.49
Minimum 4982.40
Maximum 5736.98
Spread ( max - min ) 754.58
Range [ ( max - min ) / 2 * 100% ] 7.08%
Standard Deviation 125.2569
5th Percentile 5126.58
95th Percentile 5546.25
( 95th Percentile - 5th Percentile ) 419.67
Mean Distribution
Standard Deviation 5.0386
95.00% Confidence Interval ( 5316.61 - 5336.36 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2125
0.1 Scale Factor Error with Delta=300 134
0.05 Scale Factor Error with Delta=300 536
0.01 Scale Factor Error with Delta=300 13394
DPS(e)
Necro_CombustingEngine Damage Per Second (Effective)
Count 618
Mean 9648.88
Minimum 9016.96
Maximum 10295.78
Spread ( max - min ) 1278.81
Range [ ( max - min ) / 2 * 100% ] 6.63%
Damage
Necro_CombustingEngine Damage
Count 618
Mean 2501711.56
Minimum 2028591.48
Maximum 3026684.20
Spread ( max - min ) 998092.72
Range [ ( max - min ) / 2 * 100% ] 19.95%
DTPS
Necro_CombustingEngine Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necro_CombustingEngine Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necro_CombustingEngine Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necro_CombustingEngine Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necro_CombustingEngine Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necro_CombustingEngine Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necro_CombustingEngineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necro_CombustingEngine Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.68 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.64 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.06 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.99 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.28 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.50 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.36 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.01 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.88 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.92 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.81 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.96 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.76 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.45 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.85 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDFEFFJDLKLKDLALKEHQQRPNQ9FKFEILKLALKHQRQPRNEIFJLKLLKIA9HRNQQRNPEFFILKLLLAKIHRRNQRRPE9FFIJKLIAHRNQRNQPEFKLFKMDLKLDLAHNOQQNDEJFFFIKLLKLAHQNQRRPEKILF9KILLLAHNQRNQRPEFJFIKLKLLLIAHRNOQNEILLKFIL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.900 cds M summon_infernal Fluffy_Pillow 49700.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.906 aoe H havoc enemy2 49203.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.913 havoc Q chaos_bolt Fluffy_Pillow 48706.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.922 havoc N conflagrate Fluffy_Pillow 49711.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.929 havoc Q chaos_bolt Fluffy_Pillow 49714.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.335 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.340 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.348 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.753 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:14.759 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.164 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.170 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.178 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:19.186 aoe E channel_demonfire Fluffy_Pillow 49253.0/50000: 99% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:21.434 aoe F immolate enemy2 49627.0/50000: 99% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.440 aoe F immolate enemy3 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.445 aoe J decimating_bolt Fluffy_Pillow 49004.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:25.118 aoe D rain_of_fire Fluffy_Pillow 47841.0/50000: 96% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:26.124 aoe L incinerate Fluffy_Pillow 48344.0/50000: 97% mana
0.9/5: 18% soul_shard
bloodlust, backdraft
0:27.063 aoe K conflagrate Fluffy_Pillow 47813.5/50000: 96% mana
1.4/5: 28% soul_shard
bloodlust, decimating_bolt(2)
0:28.071 aoe L incinerate Fluffy_Pillow 47817.5/50000: 96% mana
2.3/5: 46% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:29.010 aoe K conflagrate Fluffy_Pillow 47287.0/50000: 95% mana
2.8/5: 56% soul_shard
bloodlust, decimating_bolt
0:30.016 aoe D rain_of_fire Fluffy_Pillow 47290.0/50000: 95% mana
3.7/5: 74% soul_shard
bloodlust, backdraft, decimating_bolt
0:31.023 aoe L incinerate Fluffy_Pillow 47793.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust, backdraft, decimating_bolt
0:31.962 default A cataclysm Fluffy_Pillow 47263.0/50000: 95% mana
1.6/5: 32% soul_shard
bloodlust
0:33.303 aoe L incinerate Fluffy_Pillow 47433.5/50000: 95% mana
1.9/5: 38% soul_shard
bloodlust
0:34.644 aoe K conflagrate Fluffy_Pillow 47104.0/50000: 94% mana
2.6/5: 52% soul_shard
bloodlust
0:35.650 aoe E channel_demonfire Fluffy_Pillow 47107.0/50000: 94% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:38.166 aoe H havoc enemy2 47615.0/50000: 95% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:39.174 havoc Q chaos_bolt Fluffy_Pillow 47119.0/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:40.580 havoc Q chaos_bolt Fluffy_Pillow 47822.0/50000: 96% mana
2.1/5: 42% soul_shard
bloodlust
0:42.589 havoc R incinerate Fluffy_Pillow 48826.5/50000: 98% mana
0.4/5: 8% soul_shard
0:44.329 havoc P immolate Fluffy_Pillow 48696.5/50000: 97% mana
0.9/5: 18% soul_shard
0:45.635 havoc N conflagrate Fluffy_Pillow 48599.5/50000: 97% mana
1.1/5: 22% soul_shard
0:46.942 havoc Q chaos_bolt Fluffy_Pillow 48753.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
0:48.771 default 9 soul_fire Fluffy_Pillow 49667.5/50000: 99% mana
0.5/5: 10% soul_shard
0:52.248 aoe F immolate enemy3 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
0:53.555 aoe K conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
2.2/5: 44% soul_shard
0:54.862 aoe F immolate enemy2 49059.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:56.168 aoe E channel_demonfire Fluffy_Pillow 48962.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
0:59.072 aoe I rain_of_fire Fluffy_Pillow 49664.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
1:00.379 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:01.597 aoe K conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
1:02.901 aoe L incinerate Fluffy_Pillow 49153.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
1:04.122 default A cataclysm Fluffy_Pillow 48764.0/50000: 98% mana
1.8/5: 36% soul_shard
1:05.864 aoe L incinerate Fluffy_Pillow 49135.0/50000: 98% mana
2.2/5: 44% soul_shard
1:07.604 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
1:08.912 aoe H havoc enemy2 49156.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:10.219 havoc Q chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:12.046 havoc R incinerate Fluffy_Pillow 49723.0/50000: 99% mana
1.7/5: 34% soul_shard
1:13.786 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
1:16.394 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:17.700 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
1:19.439 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
1:20.746 aoe E channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:23.592 aoe I rain_of_fire Fluffy_Pillow 49828.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:24.899 aoe F immolate enemy3 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
1:26.206 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
1:28.382 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.6/5: 12% soul_shard
backdraft
1:29.599 aoe K conflagrate Fluffy_Pillow 47611.0/50000: 95% mana
1.0/5: 20% soul_shard
1:30.905 aoe L incinerate Fluffy_Pillow 47764.0/50000: 96% mana
1.5/5: 30% soul_shard
backdraft, decimating_bolt(3)
1:32.123 aoe L incinerate Fluffy_Pillow 47373.0/50000: 95% mana
2.1/5: 42% soul_shard
decimating_bolt(2)
1:33.865 aoe K conflagrate Fluffy_Pillow 47244.0/50000: 94% mana
2.5/5: 50% soul_shard
decimating_bolt
1:35.170 aoe I rain_of_fire Fluffy_Pillow 47396.5/50000: 95% mana
3.1/5: 62% soul_shard
backdraft, decimating_bolt
1:36.476 default A cataclysm Fluffy_Pillow 48049.5/50000: 96% mana
0.5/5: 10% soul_shard
backdraft, decimating_bolt
1:38.217 default 9 soul_fire Fluffy_Pillow 48420.0/50000: 97% mana
0.5/5: 10% soul_shard
backdraft, decimating_bolt
1:41.696 aoe H havoc enemy2 49003.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft, decimating_bolt
1:43.003 havoc R incinerate Fluffy_Pillow 48656.5/50000: 97% mana
1.9/5: 38% soul_shard
backdraft, decimating_bolt
1:44.223 havoc N conflagrate Fluffy_Pillow 48266.5/50000: 97% mana
2.6/5: 52% soul_shard
1:45.529 havoc Q chaos_bolt Fluffy_Pillow 48419.5/50000: 97% mana
3.6/5: 72% soul_shard
backdraft
1:47.356 havoc Q chaos_bolt Fluffy_Pillow 49333.0/50000: 99% mana
2.1/5: 42% soul_shard
1:49.966 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
1:51.705 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
1:53.013 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:54.320 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:57.221 aoe F immolate enemy3 49759.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:58.528 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
1:59.835 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:01.141 aoe L incinerate Fluffy_Pillow 49809.0/50000: 100% mana
0.0/5: 0% soul_shard
backdraft
2:02.360 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.4/5: 8% soul_shard
2:03.666 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
2:04.886 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
1.4/5: 28% soul_shard
2:06.625 aoe L incinerate Fluffy_Pillow 48634.5/50000: 97% mana
1.7/5: 34% soul_shard
2:08.366 default A cataclysm Fluffy_Pillow 48505.0/50000: 97% mana
2.3/5: 46% soul_shard
2:10.106 aoe K conflagrate Fluffy_Pillow 48875.0/50000: 98% mana
2.6/5: 52% soul_shard
2:11.412 aoe I rain_of_fire Fluffy_Pillow 49028.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
2:12.718 aoe H havoc enemy2 49681.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
2:14.025 havoc R incinerate Fluffy_Pillow 49334.5/50000: 99% mana
0.5/5: 10% soul_shard
backdraft
2:15.244 havoc R incinerate Fluffy_Pillow 48944.0/50000: 98% mana
1.0/5: 20% soul_shard
2:16.985 havoc N conflagrate Fluffy_Pillow 48814.5/50000: 98% mana
1.7/5: 34% soul_shard
2:18.291 havoc Q chaos_bolt Fluffy_Pillow 48967.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:20.119 havoc R incinerate Fluffy_Pillow 49881.5/50000: 100% mana
1.1/5: 22% soul_shard
2:21.860 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
2:23.601 havoc P immolate Fluffy_Pillow 48873.0/50000: 98% mana
2.5/5: 50% soul_shard
2:24.908 aoe E channel_demonfire Fluffy_Pillow 48776.5/50000: 98% mana
2.5/5: 50% soul_shard
2:27.648 default 9 soul_fire Fluffy_Pillow 49396.5/50000: 99% mana
2.8/5: 56% soul_shard
2:31.127 aoe F immolate enemy2 49003.0/50000: 98% mana
4.5/5: 90% soul_shard
2:32.434 aoe F immolate enemy3 48906.5/50000: 98% mana
4.5/5: 90% soul_shard
2:33.740 aoe I rain_of_fire Fluffy_Pillow 48809.5/50000: 98% mana
4.8/5: 96% soul_shard
2:35.048 aoe J decimating_bolt Fluffy_Pillow 49463.5/50000: 99% mana
1.9/5: 38% soul_shard
2:37.224 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
2.1/5: 42% soul_shard
2:38.531 aoe L incinerate Fluffy_Pillow 48156.0/50000: 96% mana
2.8/5: 56% soul_shard
backdraft
2:39.750 aoe I rain_of_fire Fluffy_Pillow 47765.5/50000: 96% mana
3.1/5: 62% soul_shard
decimating_bolt(2)
2:41.056 default A cataclysm Fluffy_Pillow 48418.5/50000: 97% mana
0.3/5: 6% soul_shard
decimating_bolt(2)
2:42.798 aoe H havoc enemy2 48789.5/50000: 98% mana
0.4/5: 8% soul_shard
decimating_bolt(2)
2:44.104 havoc R incinerate Fluffy_Pillow 48442.5/50000: 97% mana
0.6/5: 12% soul_shard
decimating_bolt(2)
2:45.843 havoc N conflagrate Fluffy_Pillow 48312.0/50000: 97% mana
1.2/5: 24% soul_shard
decimating_bolt
2:47.149 havoc Q chaos_bolt Fluffy_Pillow 48465.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, decimating_bolt
2:48.977 havoc R incinerate Fluffy_Pillow 49379.0/50000: 99% mana
0.7/5: 14% soul_shard
decimating_bolt
2:50.720 havoc N conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
1.3/5: 26% soul_shard
2:52.027 havoc Q chaos_bolt Fluffy_Pillow 49157.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:53.854 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:55.160 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
2:58.062 aoe F immolate enemy2 49953.0/50000: 100% mana
1.2/5: 24% soul_shard
2:59.369 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
3:00.677 aoe L incinerate Fluffy_Pillow 49406.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
3:01.897 aoe F immolate enemy3 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
3:03.202 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.4/5: 48% soul_shard
3:04.507 cds M summon_infernal Fluffy_Pillow 49057.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:05.815 aoe D rain_of_fire Fluffy_Pillow 48711.5/50000: 97% mana
3.5/5: 70% soul_shard
backdraft
3:07.121 aoe L incinerate Fluffy_Pillow 49364.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
3:08.341 aoe K conflagrate Fluffy_Pillow 48974.5/50000: 98% mana
1.5/5: 30% soul_shard
3:09.648 aoe L incinerate Fluffy_Pillow 49128.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
3:10.868 aoe D rain_of_fire Fluffy_Pillow 48738.0/50000: 97% mana
3.0/5: 60% soul_shard
3:12.174 aoe L incinerate Fluffy_Pillow 49391.0/50000: 99% mana
0.4/5: 8% soul_shard
3:13.915 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
3:15.654 aoe H havoc enemy2 49372.0/50000: 99% mana
1.8/5: 36% soul_shard
3:16.961 havoc N conflagrate Fluffy_Pillow 49025.5/50000: 98% mana
2.0/5: 40% soul_shard
3:18.267 havoc O soul_fire Fluffy_Pillow 49178.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
3:21.744 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:23.572 havoc Q chaos_bolt Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.183 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
3:27.491 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
3:28.799 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
3:31.625 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:33.801 aoe F immolate Fluffy_Pillow 48002.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft
3:35.108 aoe F immolate enemy3 47906.0/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
3:36.414 aoe F immolate enemy2 47809.0/50000: 96% mana
2.9/5: 58% soul_shard
decimating_bolt(3)
3:37.722 aoe I rain_of_fire Fluffy_Pillow 47713.0/50000: 95% mana
3.1/5: 62% soul_shard
decimating_bolt(3)
3:39.030 aoe K conflagrate Fluffy_Pillow 48367.0/50000: 97% mana
0.2/5: 4% soul_shard
decimating_bolt(3)
3:40.336 aoe L incinerate Fluffy_Pillow 48520.0/50000: 97% mana
0.9/5: 18% soul_shard
backdraft, decimating_bolt(3)
3:41.554 aoe L incinerate Fluffy_Pillow 48129.0/50000: 96% mana
1.2/5: 24% soul_shard
decimating_bolt(2)
3:43.295 aoe K conflagrate Fluffy_Pillow 47999.5/50000: 96% mana
1.7/5: 34% soul_shard
decimating_bolt
3:44.602 aoe L incinerate Fluffy_Pillow 48153.0/50000: 96% mana
2.4/5: 48% soul_shard
backdraft, decimating_bolt
3:45.821 default A cataclysm Fluffy_Pillow 47762.5/50000: 96% mana
2.7/5: 54% soul_shard
3:47.563 aoe H havoc enemy2 48133.5/50000: 96% mana
2.9/5: 58% soul_shard
3:48.869 havoc Q chaos_bolt Fluffy_Pillow 47786.5/50000: 96% mana
3.0/5: 60% soul_shard
3:51.479 havoc N conflagrate Fluffy_Pillow 49091.5/50000: 98% mana
1.3/5: 26% soul_shard
3:52.828 havoc Q chaos_bolt Fluffy_Pillow 49266.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
3:54.654 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
3:56.394 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
3:58.134 havoc P immolate Fluffy_Pillow 48872.0/50000: 98% mana
2.1/5: 42% soul_shard
3:59.442 aoe E channel_demonfire Fluffy_Pillow 48776.0/50000: 98% mana
2.2/5: 44% soul_shard
4:02.257 aoe K conflagrate Fluffy_Pillow 49433.5/50000: 99% mana
2.7/5: 54% soul_shard
4:03.564 aoe I rain_of_fire Fluffy_Pillow 49587.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
4:04.869 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
4:06.089 aoe F immolate enemy3 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
4:07.394 default 9 soul_fire Fluffy_Pillow 48905.0/50000: 98% mana
1.1/5: 22% soul_shard
4:10.872 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
4:12.179 aoe I rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:13.487 aoe L incinerate Fluffy_Pillow 49810.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
4:14.706 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
4:16.446 aoe L incinerate Fluffy_Pillow 48872.0/50000: 98% mana
1.4/5: 28% soul_shard
4:18.187 default A cataclysm Fluffy_Pillow 48742.5/50000: 97% mana
1.9/5: 38% soul_shard
4:19.927 aoe H havoc enemy2 49112.5/50000: 98% mana
2.0/5: 40% soul_shard
4:21.234 havoc N conflagrate Fluffy_Pillow 48766.0/50000: 98% mana
2.3/5: 46% soul_shard
4:22.540 havoc Q chaos_bolt Fluffy_Pillow 48919.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
4:24.368 havoc R incinerate Fluffy_Pillow 49833.0/50000: 100% mana
1.6/5: 32% soul_shard
4:26.110 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
4:27.424 havoc Q chaos_bolt Fluffy_Pillow 49160.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
4:29.251 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
4:30.991 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
4:32.297 aoe E channel_demonfire Fluffy_Pillow 48905.0/50000: 98% mana
2.4/5: 48% soul_shard
4:35.014 aoe F immolate enemy2 49513.5/50000: 99% mana
2.6/5: 52% soul_shard
4:36.321 aoe J decimating_bolt Fluffy_Pillow 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
4:38.496 aoe F immolate enemy3 48002.0/50000: 96% mana
2.8/5: 56% soul_shard
4:39.804 aoe I rain_of_fire Fluffy_Pillow 47906.0/50000: 96% mana
3.2/5: 64% soul_shard
4:41.110 aoe K conflagrate Fluffy_Pillow 48559.0/50000: 97% mana
0.2/5: 4% soul_shard
decimating_bolt(3)
4:42.418 aoe L incinerate Fluffy_Pillow 48713.0/50000: 97% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt(3)
4:43.639 aoe K conflagrate Fluffy_Pillow 48323.5/50000: 97% mana
1.3/5: 26% soul_shard
decimating_bolt(2)
4:44.946 aoe L incinerate Fluffy_Pillow 48477.0/50000: 97% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(2)
4:46.165 aoe L incinerate Fluffy_Pillow 48086.5/50000: 96% mana
2.3/5: 46% soul_shard
decimating_bolt
4:47.905 aoe L incinerate Fluffy_Pillow 47956.5/50000: 96% mana
2.9/5: 58% soul_shard
4:49.648 aoe I rain_of_fire Fluffy_Pillow 47828.0/50000: 96% mana
3.6/5: 72% soul_shard
4:50.954 default A cataclysm Fluffy_Pillow 48481.0/50000: 97% mana
0.6/5: 12% soul_shard
4:52.695 aoe H havoc enemy2 48851.5/50000: 98% mana
0.9/5: 18% soul_shard
4:54.001 havoc R incinerate Fluffy_Pillow 48504.5/50000: 97% mana
0.9/5: 18% soul_shard
4:55.741 havoc N conflagrate Fluffy_Pillow 48374.5/50000: 97% mana
1.7/5: 34% soul_shard
4:57.048 havoc O soul_fire Fluffy_Pillow 48528.0/50000: 97% mana
2.8/5: 56% soul_shard
backdraft
5:00.528 havoc Q chaos_bolt Fluffy_Pillow 49003.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
5:02.353 havoc N conflagrate Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
5:03.661 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
backdraft
5:06.573 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
5:07.882 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
5:09.102 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
5:10.842 aoe K conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.6/5: 52% soul_shard
5:12.147 aoe F immolate enemy3 49025.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
5:13.455 aoe I rain_of_fire Fluffy_Pillow 48929.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
5:14.760 aoe L incinerate Fluffy_Pillow 49581.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necro_CombustingEngine"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=212:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necro_DuplicitousHavoc : 9714 dps, 5241 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9714.4 9714.4 16.6 / 0.170% 765.9 / 7.9% 20.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
405.9 402.3 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necro_DuplicitousHavoc 9714
Cataclysm 770 7.9% 9.6 32.51sec 23894 14066 Direct 28.7 6701 13397 7965 18.9%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 28.72 0.00 0.00 1.6987 0.0000 228728.42 228728.42 0.00% 14066.07 14066.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 23.30 13 32 6700.57 6141 7261 6700.29 6514 6911 156115 156115 0.00%
crit 18.87% 5.42 1 13 13397.14 12284 14520 13405.77 12284 14392 72613 72613 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.64
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1015) 0.0% (10.5%) 12.0 26.05sec 25232 9373

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.97 0.00 178.77 0.00 2.6921 0.1633 0.00 0.00 0.00% 9372.64 9372.64

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.97
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1015 10.5% 0.0 0.00sec 0 0 Direct 536.3 471 945 563 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 536.32 0.00 0.00 0.0000 0.0000 301930.19 301930.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 432.48 291 562 471.28 263 976 471.63 444 496 203807 203807 0.00%
crit 19.36% 103.84 63 150 945.03 525 1952 946.08 804 1094 98123 98123 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1402 (1868) 14.4% (19.2%) 22.4 12.96sec 24728 12479 Direct 44.6 (88.8) 0 9325 9325 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.43 44.63 0.00 0.00 1.9816 0.0000 416165.50 416165.50 0.00% 12479.22 12479.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.63 34 60 9324.71 7326 11548 9324.65 9134 9497 416166 416166 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.54
  • if_expr:cast_time<havoc_remains
    Internal Combustion 467 4.8% 44.2 12.93sec 3131 0 Direct 44.2 2630 5268 3134 19.0%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.22 44.21 0.00 0.00 0.0000 0.0000 138461.14 138461.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.98% 35.80 22 50 2629.87 1 3715 2632.38 2448 2843 94161 94161 0.00%
crit 19.02% 8.41 1 18 5267.70 2 7430 5277.12 3881 6555 44300 44300 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 867 8.9% 36.7 7.95sec 7018 5617 Direct 56.5 3827 7642 4556 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.72 56.53 0.00 0.00 1.2493 0.0000 257674.35 257674.35 0.00% 5617.25 5617.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 45.70 30 62 3827.05 2559 5042 3826.34 3614 4001 174889 174889 0.00%
crit 19.16% 10.83 2 22 7641.92 5118 10084 7649.87 6168 9276 82786 82786 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.94
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.77
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (100) 0.0% (1.0%) 5.0 60.56sec 5975 2880

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.98 0.00 0.00 0.00 2.0749 0.0000 0.00 0.00 0.00% 2879.67 2879.67

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.02
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 100 1.0% 0.0 0.00sec 0 0 Direct 19.8 1258 2511 1505 19.7%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.78 0.00 0.00 0.0000 0.0000 29758.51 29758.51 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.30% 15.88 9 25 1257.85 899 1674 1254.74 1152 1383 19969 19969 0.00%
crit 19.70% 3.90 0 11 2511.42 1799 3348 2475.02 0 3310 9789 9789 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1619 16.7% 27.0 10.76sec 17865 14156 Direct 34.4 1600 3184 1913 19.7%
Periodic 343.3 1014 2026 1211 19.4% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.96 34.43 343.34 343.34 1.2620 2.4827 481649.20 481649.20 0.00% 543.35 14156.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.28% 27.64 17 38 1599.81 1024 2017 1600.36 1495 1690 44221 44221 0.00%
crit 19.72% 6.79 1 15 3184.28 2050 4033 3183.46 2595 3998 21631 21631 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.56% 276.59 215 349 1014.17 0 1261 1014.34 994 1034 280515 280515 0.00%
crit 19.44% 66.76 39 101 2026.21 3 2521 2026.35 1918 2122 135282 135282 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.33
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.75
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 780 8.1% 40.4 6.64sec 5753 3915 Direct 49.7 (49.7) 3913 7890 4680 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.41 49.69 0.00 0.00 1.4693 0.0000 232495.37 232495.37 0.00% 3915.38 3915.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 40.10 24 61 3912.80 1640 8339 3920.84 3166 4814 156839 156839 0.00%
crit 19.31% 9.59 2 20 7890.20 3281 16725 7932.34 4739 12171 75657 75657 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.01
    havoc
    [R]:9.65
  • if_expr:cast_time<havoc_remains
Rain of Fire 861 8.9% 16.3 17.09sec 15649 12513 Periodic 387.0 553 1106 661 19.5% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.33 0.00 0.00 386.95 1.2506 0.0000 255623.13 255623.13 0.00% 12513.37 12513.37
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.51% 311.55 190 438 552.86 507 599 552.87 544 560 172244 172244 0.00%
crit 19.49% 75.40 44 110 1105.69 1013 1198 1105.79 1083 1138 83379 83379 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.05
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.28
Soul Fire 521 5.4% 5.5 49.40sec 27874 8015 Direct 7.4 17511 34815 20742 18.8%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.45 0.00 0.00 3.4775 0.0000 154658.69 154658.69 0.00% 8015.48 8015.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.23% 6.05 2 9 17511.49 10946 21175 17526.92 14600 20553 105968 105968 0.00%
crit 18.77% 1.40 0 6 34815.24 23312 42336 27137.03 0 42291 48691 48691 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.69
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.95
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.61sec 12111 10477 Direct 6.0 3348 6696 4040 20.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24222.51 24222.51 0.00% 10476.86 10476.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.42% 4.77 1 6 3348.13 3348 3348 3348.13 3348 3348 15955 15955 0.00%
crit 20.58% 1.23 0 5 6696.27 6696 6696 4930.10 0 6696 8267 8267 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3510 / 717
Immolation 3245 6.7% 39.0 5.49sec 4992 0 Direct 117.0 1395 2790 1664 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194678.07 194678.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 94.45 81 109 1395.06 1395 1395 1395.06 1395 1395 131765 131765 0.00%
crit 19.27% 22.55 8 36 2790.11 2790 2790 2790.11 2790 2790 62913 62913 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 388 270 Direct 41.0 326 651 388 19.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15900.43 22712.18 29.99% 269.94 269.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 33.16 25 39 325.55 326 326 325.55 326 326 10795 15419 29.99%
crit 19.13% 7.84 2 16 651.10 651 651 651.10 651 651 5106 7293 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 515 / 515
Firebolt 515 5.3% 92.6 3.21sec 1653 1136 Direct 91.9 1395 2790 1666 19.4%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 153056.63 153056.63 0.00% 1135.51 1135.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 74.03 55 96 1395.06 1395 1395 1395.06 1395 1395 103282 103282 0.00%
crit 19.42% 17.84 6 33 2790.11 2790 2790 2790.11 2790 2790 49775 49775 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Necro_DuplicitousHavoc
Havoc 9.5 32.29sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.50 0.00 0.00 0.00 1.2434 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.51
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.2sec 52.25% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.5s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.25%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 4.9 0.0 60.9sec 60.9sec 10.0sec 16.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 73.8s
  • trigger_min/max:47.2s / 73.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.8s

Stack Uptimes

  • decimating_bolt_1:6.53%
  • decimating_bolt_2:5.98%
  • decimating_bolt_3:3.97%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necro_DuplicitousHavoc_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necro_DuplicitousHavoc_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.11% 8.37% 14.78% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necro_DuplicitousHavoc
soul_fire Soul Shard 6.56 7.27 7.81% 1.11 0.23 3.13%
immolate Soul Shard 343.41 33.01 35.44% 0.10 1.33 3.87%
incinerate Soul Shard 40.45 10.01 10.74% 0.25 0.00 0.01%
conflagrate Soul Shard 36.71 28.25 30.33% 0.77 0.00 0.00%
mana_regen Mana 660.42 119756.21 100.00% 181.33 28758.59 19.36%
immolate_crits Soul Shard 33.25 3.20 3.44% 0.10 0.12 3.64%
incinerate_crits Soul Shard 9.59 0.96 1.03% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.43 11.20% 0.09 1.57 13.07%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.30 405.86 28773.3 48940.2 46765.5 50000.0
Soul Shard 4.0 0.31 0.32 3.3 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necro_DuplicitousHavoc
cataclysm Mana 9.6 4791.8 500.0 500.6 47.7
channel_demonfire Mana 12.0 8978.7 750.0 750.4 33.6
chaos_bolt Soul Shard 22.4 44.8 2.0 2.0 12372.7
conflagrate Mana 36.7 18354.1 500.0 499.9 14.0
decimating_bolt Mana 5.0 9965.3 2000.0 2000.8 3.0
havoc Mana 9.5 9509.5 1000.0 1000.5 0.0
immolate Mana 27.0 20216.9 750.0 749.9 23.8
incinerate Mana 40.4 40446.4 1000.0 1000.8 5.7
rain_of_fire Soul Shard 16.3 49.0 3.0 3.0 5218.5
soul_fire Mana 6.6 6559.9 1000.0 1182.3 23.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.1
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Necro_DuplicitousHavoc Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Necro_DuplicitousHavoc Damage Per Second
Count 618
Mean 9714.35
Minimum 9208.44
Maximum 10359.12
Spread ( max - min ) 1150.68
Range [ ( max - min ) / 2 * 100% ] 5.92%
Standard Deviation 210.0736
5th Percentile 9398.57
95th Percentile 10088.29
( 95th Percentile - 5th Percentile ) 689.72
Mean Distribution
Standard Deviation 8.4504
95.00% Confidence Interval ( 9697.79 - 9730.92 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1797
0.1 Scale Factor Error with Delta=300 377
0.05 Scale Factor Error with Delta=300 1507
0.01 Scale Factor Error with Delta=300 37673
Priority Target DPS
Necro_DuplicitousHavoc Priority Target Damage Per Second
Count 618
Mean 5240.63
Minimum 4922.40
Maximum 5663.49
Spread ( max - min ) 741.09
Range [ ( max - min ) / 2 * 100% ] 7.07%
Standard Deviation 122.7934
5th Percentile 5049.70
95th Percentile 5449.67
( 95th Percentile - 5th Percentile ) 399.97
Mean Distribution
Standard Deviation 4.9395
95.00% Confidence Interval ( 5230.95 - 5250.31 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2110
0.1 Scale Factor Error with Delta=300 129
0.05 Scale Factor Error with Delta=300 515
0.01 Scale Factor Error with Delta=300 12872
DPS(e)
Necro_DuplicitousHavoc Damage Per Second (Effective)
Count 618
Mean 9714.35
Minimum 9208.44
Maximum 10359.12
Spread ( max - min ) 1150.68
Range [ ( max - min ) / 2 * 100% ] 5.92%
Damage
Necro_DuplicitousHavoc Damage
Count 618
Mean 2521367.00
Minimum 2047265.91
Maximum 3062650.30
Spread ( max - min ) 1015384.39
Range [ ( max - min ) / 2 * 100% ] 20.14%
DTPS
Necro_DuplicitousHavoc Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necro_DuplicitousHavoc Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necro_DuplicitousHavoc Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necro_DuplicitousHavoc Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necro_DuplicitousHavoc Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necro_DuplicitousHavoc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necro_DuplicitousHavocTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necro_DuplicitousHavoc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.69 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.64 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.05 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.97 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.33 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.51 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.28 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.02 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.94 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.01 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.77 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.95 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.75 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.54 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.65 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDJKLKDLLALEHNQQNPOILKFIELKLLALHNQQRNPEIJFKLLLI9AHNQNQRRNEFFIFLKLLLIKAHRQRNPQ9EJFIKFLKLLAHNQQRNPEILKLFMLDKL9AHQNQQNPDEFJFKILLKLLAHQNQPRRN9EFIFKILLKAHRQNQRPEJKLFILKLLLLA9EHQNQNPQNFI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.930 cds M summon_infernal Fluffy_Pillow 49715.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.937 aoe H havoc enemy2 49218.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.943 havoc Q chaos_bolt Fluffy_Pillow 48721.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.951 havoc N conflagrate Fluffy_Pillow 49725.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.958 havoc Q chaos_bolt Fluffy_Pillow 49729.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.364 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.370 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.378 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.785 havoc N conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.791 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.198 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:17.204 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.210 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.604 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.611 aoe F immolate enemy2 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:22.616 aoe F immolate enemy3 49005.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.623 aoe D rain_of_fire Fluffy_Pillow 48758.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.629 aoe J decimating_bolt Fluffy_Pillow 49261.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.304 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
1.1/5: 22% soul_shard
bloodlust
0:27.311 aoe L incinerate Fluffy_Pillow 48006.0/50000: 96% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:28.249 aoe K conflagrate Fluffy_Pillow 47475.0/50000: 95% mana
2.5/5: 50% soul_shard
bloodlust, decimating_bolt(2)
0:29.256 aoe D rain_of_fire Fluffy_Pillow 47478.5/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:30.262 aoe L incinerate Fluffy_Pillow 47981.5/50000: 96% mana
0.8/5: 16% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.202 aoe L incinerate Fluffy_Pillow 47451.5/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, decimating_bolt
0:32.542 default A cataclysm Fluffy_Pillow 47121.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust
0:33.882 aoe L incinerate Fluffy_Pillow 47291.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust
0:35.221 aoe E channel_demonfire Fluffy_Pillow 46961.0/50000: 94% mana
3.0/5: 60% soul_shard
bloodlust
0:37.470 aoe H havoc enemy2 47335.5/50000: 95% mana
3.3/5: 66% soul_shard
bloodlust
0:38.478 havoc N conflagrate Fluffy_Pillow 46839.5/50000: 94% mana
3.5/5: 70% soul_shard
bloodlust
0:39.482 havoc Q chaos_bolt Fluffy_Pillow 46841.5/50000: 94% mana
4.6/5: 92% soul_shard
bloodlust, backdraft
0:40.887 havoc Q chaos_bolt Fluffy_Pillow 47544.0/50000: 95% mana
2.9/5: 58% soul_shard
bloodlust
0:42.893 havoc N conflagrate Fluffy_Pillow 48547.0/50000: 97% mana
1.2/5: 24% soul_shard
0:44.199 havoc P immolate Fluffy_Pillow 48700.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft
0:45.507 havoc O soul_fire Fluffy_Pillow 48604.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft
0:48.983 aoe I rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:50.291 aoe L incinerate Fluffy_Pillow 49655.5/50000: 99% mana
2.0/5: 40% soul_shard
backdraft
0:51.511 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
0:52.817 aoe F immolate enemy3 49155.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
0:54.123 aoe I rain_of_fire Fluffy_Pillow 49058.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
0:55.431 aoe E channel_demonfire Fluffy_Pillow 49712.5/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
0:58.239 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
0:59.459 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
1:00.766 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:01.984 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
2.1/5: 42% soul_shard
1:03.726 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
2.6/5: 52% soul_shard
1:05.616 aoe L incinerate Fluffy_Pillow 49081.0/50000: 98% mana
2.9/5: 58% soul_shard
1:07.355 aoe H havoc enemy2 48950.5/50000: 98% mana
3.2/5: 64% soul_shard
1:08.776 havoc N conflagrate Fluffy_Pillow 48661.0/50000: 97% mana
3.5/5: 70% soul_shard
1:10.083 havoc Q chaos_bolt Fluffy_Pillow 48814.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
1:11.912 havoc Q chaos_bolt Fluffy_Pillow 49729.0/50000: 99% mana
2.8/5: 56% soul_shard
1:14.521 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
1:16.262 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
1:17.569 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:18.874 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
1:21.699 aoe I rain_of_fire Fluffy_Pillow 49721.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
1:23.007 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:25.182 aoe F immolate enemy3 48002.0/50000: 96% mana
1.0/5: 20% soul_shard
backdraft
1:26.490 aoe K conflagrate Fluffy_Pillow 47906.0/50000: 96% mana
1.2/5: 24% soul_shard
1:27.795 aoe L incinerate Fluffy_Pillow 48058.5/50000: 96% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt(3)
1:29.015 aoe L incinerate Fluffy_Pillow 47668.5/50000: 95% mana
2.2/5: 44% soul_shard
decimating_bolt(2)
1:30.756 aoe L incinerate Fluffy_Pillow 47539.0/50000: 95% mana
2.6/5: 52% soul_shard
decimating_bolt
1:32.498 aoe I rain_of_fire Fluffy_Pillow 47410.0/50000: 95% mana
3.2/5: 64% soul_shard
1:33.804 default 9 soul_fire Fluffy_Pillow 48063.0/50000: 96% mana
0.3/5: 6% soul_shard
1:37.456 default A cataclysm Fluffy_Pillow 48889.0/50000: 98% mana
2.1/5: 42% soul_shard
1:39.194 aoe H havoc enemy2 49258.0/50000: 99% mana
2.2/5: 44% soul_shard
1:40.501 havoc N conflagrate Fluffy_Pillow 48911.5/50000: 98% mana
2.2/5: 44% soul_shard
1:41.807 havoc Q chaos_bolt Fluffy_Pillow 49064.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
1:43.635 havoc N conflagrate Fluffy_Pillow 49978.5/50000: 100% mana
1.5/5: 30% soul_shard
1:44.942 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:46.769 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:48.510 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
1:50.247 havoc N conflagrate Fluffy_Pillow 48871.0/50000: 98% mana
2.2/5: 44% soul_shard
1:51.780 aoe E channel_demonfire Fluffy_Pillow 49137.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
1:54.617 aoe F immolate Fluffy_Pillow 49806.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:55.921 aoe F immolate enemy2 49251.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:57.228 aoe I rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
1:58.533 aoe F immolate enemy3 49807.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:59.840 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
2:01.059 aoe K conflagrate Fluffy_Pillow 48862.0/50000: 98% mana
1.3/5: 26% soul_shard
2:02.366 aoe L incinerate Fluffy_Pillow 49015.5/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
2:03.585 aoe L incinerate Fluffy_Pillow 48625.0/50000: 97% mana
2.4/5: 48% soul_shard
2:05.324 aoe L incinerate Fluffy_Pillow 48494.5/50000: 97% mana
2.9/5: 58% soul_shard
2:07.065 aoe I rain_of_fire Fluffy_Pillow 48365.0/50000: 97% mana
3.3/5: 66% soul_shard
2:08.371 aoe K conflagrate Fluffy_Pillow 49018.0/50000: 98% mana
0.5/5: 10% soul_shard
2:09.679 default A cataclysm Fluffy_Pillow 49172.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:11.419 aoe H havoc enemy2 49502.0/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
2:12.726 havoc R incinerate Fluffy_Pillow 49155.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:13.945 havoc Q chaos_bolt Fluffy_Pillow 48765.0/50000: 98% mana
2.2/5: 44% soul_shard
2:16.553 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:18.293 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:19.598 havoc P immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:20.904 havoc Q chaos_bolt Fluffy_Pillow 49057.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:22.731 default 9 soul_fire Fluffy_Pillow 49971.0/50000: 100% mana
0.7/5: 14% soul_shard
2:26.209 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
2:29.064 aoe J decimating_bolt Fluffy_Pillow 49680.0/50000: 99% mana
2.5/5: 50% soul_shard
2:31.239 aoe F immolate enemy3 48002.0/50000: 96% mana
2.8/5: 56% soul_shard
2:32.546 aoe I rain_of_fire Fluffy_Pillow 47905.5/50000: 96% mana
3.0/5: 60% soul_shard
2:33.853 aoe K conflagrate Fluffy_Pillow 48559.0/50000: 97% mana
0.2/5: 4% soul_shard
decimating_bolt(3)
2:35.159 aoe F immolate enemy2 48712.0/50000: 97% mana
0.8/5: 16% soul_shard
backdraft, decimating_bolt(3)
2:36.466 aoe L incinerate Fluffy_Pillow 48615.5/50000: 97% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt(3)
2:37.686 aoe K conflagrate Fluffy_Pillow 48225.5/50000: 96% mana
1.3/5: 26% soul_shard
decimating_bolt(2)
2:38.993 aoe L incinerate Fluffy_Pillow 48379.0/50000: 97% mana
2.0/5: 40% soul_shard
backdraft, decimating_bolt(2)
2:40.213 aoe L incinerate Fluffy_Pillow 47989.0/50000: 96% mana
2.4/5: 48% soul_shard
decimating_bolt
2:41.954 default A cataclysm Fluffy_Pillow 47859.5/50000: 96% mana
2.8/5: 56% soul_shard
2:43.693 aoe H havoc enemy2 48229.0/50000: 96% mana
3.0/5: 60% soul_shard
2:45.000 havoc N conflagrate Fluffy_Pillow 47882.5/50000: 96% mana
3.2/5: 64% soul_shard
2:46.307 havoc Q chaos_bolt Fluffy_Pillow 48036.0/50000: 96% mana
4.3/5: 86% soul_shard
backdraft
2:48.134 havoc Q chaos_bolt Fluffy_Pillow 48949.5/50000: 98% mana
2.6/5: 52% soul_shard
2:50.743 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
2:52.482 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.5/5: 30% soul_shard
2:53.788 havoc P immolate Fluffy_Pillow 49154.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:55.096 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
2:57.942 aoe I rain_of_fire Fluffy_Pillow 49731.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:59.248 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
3:00.467 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.8/5: 16% soul_shard
3:01.772 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:02.991 aoe F immolate enemy3 48764.0/50000: 98% mana
1.8/5: 36% soul_shard
3:04.297 cds M summon_infernal Fluffy_Pillow 48667.0/50000: 97% mana
1.9/5: 38% soul_shard
3:05.603 aoe L incinerate Fluffy_Pillow 48320.0/50000: 97% mana
2.4/5: 48% soul_shard
3:07.343 aoe D rain_of_fire Fluffy_Pillow 48190.0/50000: 96% mana
3.1/5: 62% soul_shard
3:08.648 aoe K conflagrate Fluffy_Pillow 48842.5/50000: 98% mana
0.5/5: 10% soul_shard
3:09.955 aoe L incinerate Fluffy_Pillow 48996.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:11.175 default 9 soul_fire Fluffy_Pillow 48606.0/50000: 97% mana
2.0/5: 40% soul_shard
3:14.681 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.1/5: 82% soul_shard
3:16.423 aoe H havoc enemy2 49373.0/50000: 99% mana
4.8/5: 96% soul_shard
3:17.730 havoc Q chaos_bolt Fluffy_Pillow 49026.5/50000: 98% mana
5.0/5: 100% soul_shard
3:20.341 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:21.647 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:23.474 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.084 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
3:27.392 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
3:28.699 aoe D rain_of_fire Fluffy_Pillow 49252.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
3:30.006 aoe E channel_demonfire Fluffy_Pillow 49906.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:32.821 aoe F immolate enemy2 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
3:34.127 aoe J decimating_bolt Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:36.302 aoe F immolate enemy3 48002.0/50000: 96% mana
2.4/5: 48% soul_shard
3:37.609 aoe K conflagrate Fluffy_Pillow 47905.5/50000: 96% mana
2.6/5: 52% soul_shard
3:38.916 aoe I rain_of_fire Fluffy_Pillow 48059.0/50000: 96% mana
3.2/5: 64% soul_shard
backdraft, decimating_bolt(3)
3:40.222 aoe L incinerate Fluffy_Pillow 48712.0/50000: 97% mana
0.4/5: 8% soul_shard
backdraft, decimating_bolt(3)
3:41.441 aoe L incinerate Fluffy_Pillow 48321.5/50000: 97% mana
0.7/5: 14% soul_shard
decimating_bolt(2)
3:43.181 aoe K conflagrate Fluffy_Pillow 48191.5/50000: 96% mana
1.1/5: 22% soul_shard
decimating_bolt
3:44.488 aoe L incinerate Fluffy_Pillow 48345.0/50000: 97% mana
1.8/5: 36% soul_shard
backdraft, decimating_bolt
3:45.709 aoe L incinerate Fluffy_Pillow 47955.5/50000: 96% mana
2.1/5: 42% soul_shard
3:47.449 default A cataclysm Fluffy_Pillow 47825.5/50000: 96% mana
2.6/5: 52% soul_shard
3:49.190 aoe H havoc enemy2 48196.0/50000: 96% mana
2.6/5: 52% soul_shard
3:50.496 havoc Q chaos_bolt Fluffy_Pillow 47849.0/50000: 96% mana
2.8/5: 56% soul_shard
3:53.105 havoc N conflagrate Fluffy_Pillow 49153.5/50000: 98% mana
1.1/5: 22% soul_shard
3:54.412 havoc Q chaos_bolt Fluffy_Pillow 49307.0/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
3:56.239 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:57.545 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
3:59.286 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:01.026 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
2.0/5: 40% soul_shard
4:02.332 default 9 soul_fire Fluffy_Pillow 49025.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:05.810 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
4:08.731 aoe F immolate enemy3 49713.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:10.036 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
4:11.343 aoe F immolate enemy2 49905.0/50000: 100% mana
2.2/5: 44% soul_shard
4:12.650 aoe K conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.3/5: 46% soul_shard
4:13.957 aoe I rain_of_fire Fluffy_Pillow 49406.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
4:15.264 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
4:16.483 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.5/5: 10% soul_shard
4:18.223 aoe K conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
0.9/5: 18% soul_shard
4:19.530 default A cataclysm Fluffy_Pillow 49025.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
4:21.271 aoe H havoc enemy2 49396.0/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
4:22.577 havoc R incinerate Fluffy_Pillow 49049.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
4:23.797 havoc Q chaos_bolt Fluffy_Pillow 48659.0/50000: 97% mana
2.7/5: 54% soul_shard
4:26.406 havoc N conflagrate Fluffy_Pillow 49963.5/50000: 100% mana
1.0/5: 20% soul_shard
4:27.709 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:29.535 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:31.275 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
4:32.582 aoe E channel_demonfire Fluffy_Pillow 48905.5/50000: 98% mana
1.1/5: 22% soul_shard
4:35.459 aoe J decimating_bolt Fluffy_Pillow 49594.0/50000: 99% mana
1.6/5: 32% soul_shard
4:37.633 aoe K conflagrate Fluffy_Pillow 48001.5/50000: 96% mana
1.9/5: 38% soul_shard
4:38.940 aoe L incinerate Fluffy_Pillow 48155.0/50000: 96% mana
2.7/5: 54% soul_shard
backdraft
4:40.159 aoe F immolate enemy3 47764.5/50000: 96% mana
3.0/5: 60% soul_shard
decimating_bolt(2)
4:41.465 aoe I rain_of_fire Fluffy_Pillow 47667.5/50000: 95% mana
3.2/5: 64% soul_shard
decimating_bolt(2)
4:42.772 aoe L incinerate Fluffy_Pillow 48321.0/50000: 97% mana
0.3/5: 6% soul_shard
decimating_bolt(2)
4:44.511 aoe K conflagrate Fluffy_Pillow 48190.5/50000: 96% mana
0.8/5: 16% soul_shard
decimating_bolt
4:45.816 aoe L incinerate Fluffy_Pillow 48343.0/50000: 97% mana
1.3/5: 26% soul_shard
backdraft, decimating_bolt
4:47.035 aoe L incinerate Fluffy_Pillow 47952.5/50000: 96% mana
1.7/5: 34% soul_shard
4:48.776 aoe L incinerate Fluffy_Pillow 47823.0/50000: 96% mana
2.0/5: 40% soul_shard
4:50.517 aoe L incinerate Fluffy_Pillow 47693.5/50000: 95% mana
2.5/5: 50% soul_shard
4:52.258 default A cataclysm Fluffy_Pillow 47564.0/50000: 95% mana
2.9/5: 58% soul_shard
4:53.999 default 9 soul_fire Fluffy_Pillow 47934.5/50000: 96% mana
3.2/5: 64% soul_shard
4:57.474 aoe E channel_demonfire Fluffy_Pillow 48672.0/50000: 97% mana
4.6/5: 92% soul_shard
5:00.373 aoe H havoc enemy2 49371.5/50000: 99% mana
5.0/5: 100% soul_shard
5:01.678 havoc Q chaos_bolt Fluffy_Pillow 49024.0/50000: 98% mana
5.0/5: 100% soul_shard
5:04.286 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
5:05.594 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
5:07.424 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
5:08.730 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
5:10.038 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
5:11.866 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
5:13.174 aoe F immolate enemy3 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
5:14.480 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necro_DuplicitousHavoc"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=208:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necro_FatalDec : 9533 dps, 5264 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9533.3 9533.3 15.7 / 0.164% 730.2 / 7.7% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
406.2 402.6 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necro_FatalDec 9533
Cataclysm 774 8.1% 9.6 32.58sec 24048 14158 Direct 28.7 6707 13379 8010 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.58 28.73 0.00 0.00 1.6987 0.0000 230287.60 230287.60 0.00% 14157.60 14157.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.37% 23.09 14 32 6706.56 6141 7261 6706.68 6505 6926 154836 154836 0.00%
crit 19.63% 5.64 0 14 13379.21 12283 14521 13347.45 0 14488 75452 75452 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.65
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1014) 0.0% (10.6%) 12.0 25.77sec 25172 9362

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.98 0.00 178.63 0.00 2.6888 0.1633 0.00 0.00 0.00% 9362.27 9362.27

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:11.98
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1014 10.6% 0.0 0.00sec 0 0 Direct 535.9 472 944 563 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 535.89 0.00 0.00 0.0000 0.0000 301455.63 301455.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 433.22 313 564 472.03 263 976 472.36 447 500 204481 204481 0.00%
crit 19.16% 102.67 65 151 944.28 525 1952 945.47 814 1072 96975 96975 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1277 (1744) 13.4% (18.3%) 22.3 13.02sec 23178 11718 Direct 44.5 (88.5) 0 8526 8526 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.33 44.47 0.00 0.00 1.9780 0.0000 379166.29 379166.29 0.00% 11718.47 11718.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.47 34 58 8525.76 5861 11548 8525.71 8352 8720 379166 379166 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.44
  • if_expr:cast_time<havoc_remains
    Internal Combustion 467 4.9% 44.0 12.98sec 3148 0 Direct 44.0 2630 5259 3148 19.7%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.00 44.00 0.00 0.00 0.0000 0.0000 138520.35 138520.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.33% 35.35 23 52 2630.32 2 3715 2632.22 2430 2801 92989 92989 0.00%
crit 19.67% 8.66 2 19 5258.91 335 7430 5270.31 3994 6878 45532 45532 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 819 8.6% 36.7 7.94sec 6639 5314 Direct 56.5 3602 7257 4310 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.68 56.51 0.00 0.00 1.2493 0.0000 243516.74 243516.74 0.00% 5314.17 5314.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 45.57 31 62 3602.25 2047 5042 3600.53 3357 3845 164113 164113 0.00%
crit 19.35% 10.94 4 23 7256.62 4095 10083 7257.51 4947 9220 79404 79404 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.90
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.77
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (115) 0.0% (1.2%) 5.0 59.63sec 6871 3312

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.98 0.00 0.00 0.00 2.0748 0.0000 0.00 0.00 0.00% 3312.03 3312.03

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.01
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 115 1.2% 0.0 0.00sec 0 0 Direct 19.8 1448 2888 1728 19.4%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.80 0.00 0.00 0.0000 0.0000 34190.05 34190.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 15.97 8 25 1448.37 1034 1925 1444.65 1286 1614 23127 23127 0.00%
crit 19.36% 3.83 0 10 2887.74 2071 3848 2827.68 0 3847 11063 11063 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1612 16.9% 26.9 10.70sec 17839 14137 Direct 34.4 1537 3077 1838 19.5%
Periodic 343.4 1014 2029 1212 19.6% 95.5%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.89 34.39 343.41 343.41 1.2619 2.4828 479658.10 479658.10 0.00% 541.05 14136.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 27.67 18 39 1537.24 819 2017 1537.96 1441 1642 42539 42539 0.00%
crit 19.54% 6.72 0 15 3077.16 1644 4033 3082.41 0 3901 20681 20681 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.45% 276.27 214 344 1014.11 1 1261 1014.32 993 1034 280185 280185 0.00%
crit 19.55% 67.14 42 97 2028.97 13 2521 2029.65 1906 2123 136252 136252 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.26
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.75
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 764 8.0% 40.6 6.67sec 5612 3816 Direct 50.0 (50.0) 3812 7650 4558 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.60 50.02 0.00 0.00 1.4704 0.0000 227809.70 227809.70 0.00% 3816.48 3816.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 40.33 23 59 3811.87 1313 8353 3821.25 3239 4613 153718 153718 0.00%
crit 19.38% 9.70 1 19 7650.31 2624 16598 7649.68 4368 13476 74091 74091 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.05
    havoc
    [R]:9.78
  • if_expr:cast_time<havoc_remains
Rain of Fire 866 9.1% 16.4 17.20sec 15639 12503 Periodic 390.3 553 1105 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.45 0.00 0.00 390.26 1.2509 0.0000 257235.72 257235.72 0.00% 12502.95 12502.95
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 315.22 203 439 552.91 507 599 552.92 544 562 174287 174287 0.00%
crit 19.23% 75.04 45 113 1105.45 1013 1198 1105.42 1080 1134 82949 82949 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.06
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.38
Soul Fire 514 5.4% 5.5 49.34sec 27533 7918 Direct 7.5 17147 33975 20445 19.5%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.55 7.47 0.00 0.00 3.4775 0.0000 152722.61 152722.61 0.00% 7917.60 7917.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 6.02 2 9 17147.16 8606 21177 17164.39 14288 20508 103214 103214 0.00%
crit 19.48% 1.46 0 5 33975.24 18847 42347 27374.59 0 42310 49509 49509 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.67
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.97
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.74sec 12044 10418 Direct 6.0 3348 6696 4011 19.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24087.07 24087.07 0.00% 10418.28 10418.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.10% 4.81 2 6 3348.13 3348 3348 3348.13 3348 3348 16091 16091 0.00%
crit 19.90% 1.19 0 4 6696.27 6696 6696 4810.91 0 6696 7997 7997 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3500 / 715
Immolation 3235 6.9% 39.0 5.50sec 4977 0 Direct 117.0 1395 2790 1659 18.9%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194093.41 194093.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 94.87 77 109 1395.06 1395 1395 1395.06 1395 1395 132350 132350 0.00%
crit 18.91% 22.13 8 40 2790.11 2790 2790 2790.11 2790 2790 61744 61744 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.26sec 389 270 Direct 41.0 326 651 388 19.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15929.41 22753.56 29.99% 270.43 270.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 33.07 24 39 325.55 326 326 325.55 326 326 10766 15378 29.99%
crit 19.34% 7.93 2 17 651.10 651 651 651.10 651 651 5164 7376 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1650 1134 Direct 91.9 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152812.84 152812.84 0.00% 1133.71 1133.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 74.21 52 95 1395.06 1395 1395 1395.06 1395 1395 103525 103525 0.00%
crit 19.23% 17.67 7 34 2790.11 2790 2790 2790.11 2790 2790 49287 49287 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Necro_FatalDec
Havoc 9.5 32.36sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.50 0.00 0.00 0.00 1.2434 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.51
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 7.9sec 7.9sec 4.2sec 52.45% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.45%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 5.0 0.0 61.0sec 61.0sec 9.8sec 16.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 74.7s
  • trigger_min/max:47.2s / 74.7s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 36.8s

Stack Uptimes

  • decimating_bolt_1:6.47%
  • decimating_bolt_2:5.85%
  • decimating_bolt_3:3.90%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necro_FatalDec_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 187.3s
  • trigger_min/max:180.0s / 187.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necro_FatalDec_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 187.3s
  • trigger_min/max:180.0s / 187.3s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.10% 9.21% 15.16% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necro_FatalDec
soul_fire Soul Shard 6.55 7.29 7.81% 1.11 0.22 2.97%
immolate Soul Shard 343.49 33.03 35.39% 0.10 1.32 3.85%
incinerate Soul Shard 40.62 10.07 10.79% 0.25 0.00 0.00%
conflagrate Soul Shard 36.67 28.24 30.26% 0.77 0.00 0.00%
mana_regen Mana 661.29 119845.51 100.00% 181.23 28667.49 19.30%
immolate_crits Soul Shard 33.76 3.25 3.48% 0.10 0.13 3.75%
incinerate_crits Soul Shard 9.73 0.97 1.04% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.48 11.23% 0.09 1.52 12.66%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.61 406.21 28683.2 48928.3 46765.5 50000.0
Soul Shard 4.0 0.31 0.32 3.2 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necro_FatalDec
cataclysm Mana 9.6 4793.4 500.0 500.6 48.0
channel_demonfire Mana 12.0 8985.8 750.0 750.3 33.5
chaos_bolt Soul Shard 22.3 44.6 2.0 2.0 11596.0
conflagrate Mana 36.7 18336.0 500.0 499.9 13.3
decimating_bolt Mana 5.0 9962.1 2000.0 2002.1 3.4
havoc Mana 9.5 9511.0 1000.0 1000.7 0.0
immolate Mana 26.9 20168.4 750.0 750.1 23.8
incinerate Mana 40.6 40615.1 1000.0 1000.5 5.6
rain_of_fire Soul Shard 16.4 49.3 3.0 3.0 5215.1
soul_fire Mana 6.6 6553.6 1000.0 1181.5 23.3
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Necro_FatalDec Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Necro_FatalDec Damage Per Second
Count 618
Mean 9533.32
Minimum 9036.67
Maximum 10134.58
Spread ( max - min ) 1097.91
Range [ ( max - min ) / 2 * 100% ] 5.76%
Standard Deviation 198.7797
5th Percentile 9233.57
95th Percentile 9879.94
( 95th Percentile - 5th Percentile ) 646.37
Mean Distribution
Standard Deviation 7.9961
95.00% Confidence Interval ( 9517.65 - 9548.99 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1671
0.1 Scale Factor Error with Delta=300 338
0.05 Scale Factor Error with Delta=300 1350
0.01 Scale Factor Error with Delta=300 33731
Priority Target DPS
Necro_FatalDec Priority Target Damage Per Second
Count 618
Mean 5264.03
Minimum 4914.59
Maximum 5606.30
Spread ( max - min ) 691.71
Range [ ( max - min ) / 2 * 100% ] 6.57%
Standard Deviation 120.7346
5th Percentile 5071.67
95th Percentile 5467.91
( 95th Percentile - 5th Percentile ) 396.24
Mean Distribution
Standard Deviation 4.8567
95.00% Confidence Interval ( 5254.51 - 5273.55 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2021
0.1 Scale Factor Error with Delta=300 125
0.05 Scale Factor Error with Delta=300 498
0.01 Scale Factor Error with Delta=300 12444
DPS(e)
Necro_FatalDec Damage Per Second (Effective)
Count 618
Mean 9533.32
Minimum 9036.67
Maximum 10134.58
Spread ( max - min ) 1097.91
Range [ ( max - min ) / 2 * 100% ] 5.76%
Damage
Necro_FatalDec Damage
Count 618
Mean 2468649.85
Minimum 1986046.43
Maximum 3041973.15
Spread ( max - min ) 1055926.72
Range [ ( max - min ) / 2 * 100% ] 21.39%
DTPS
Necro_FatalDec Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necro_FatalDec Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necro_FatalDec Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necro_FatalDec Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necro_FatalDec Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necro_FatalDec Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necro_FatalDecTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necro_FatalDec Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.67 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.65 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.06 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 11.98 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.26 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.51 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.38 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.01 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.90 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.05 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.77 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.97 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.75 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.44 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.78 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDFEFFDJLKLDKLALKHQQRNPQR9EFFIKLKLIAHRNQRRPNEIJFLKLLLIKA9EHNQQNPQLFLKLEFIAJKLHQRNPQRN9EFIKLLAIKHRRQRNPEIJFMKLLDKLAD9EHNQNQQPNFILLLEAKIJLHRNPQNQL9EFFIKALKLLHNQQPRNEFIJLKLLAIKL9EHNQQRNPFLI

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.750 cds M summon_infernal Fluffy_Pillow 49625.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.755 aoe H havoc enemy2 49127.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.762 havoc Q chaos_bolt Fluffy_Pillow 48631.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.771 havoc N conflagrate Fluffy_Pillow 49635.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.776 havoc Q chaos_bolt Fluffy_Pillow 49638.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.184 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.191 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.197 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.604 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:14.612 havoc Q chaos_bolt Fluffy_Pillow 49959.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.018 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.026 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.032 aoe F immolate enemy2 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:19.038 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:21.218 aoe F immolate Fluffy_Pillow 49592.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.226 aoe F immolate enemy3 49253.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.233 aoe D rain_of_fire Fluffy_Pillow 49006.5/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.239 aoe J decimating_bolt Fluffy_Pillow 49509.5/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:25.914 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:26.854 aoe K conflagrate Fluffy_Pillow 47472.5/50000: 95% mana
1.8/5: 36% soul_shard
bloodlust
0:27.860 aoe L incinerate Fluffy_Pillow 47475.5/50000: 95% mana
2.7/5: 54% soul_shard
bloodlust, backdraft, decimating_bolt(3)
0:28.800 aoe D rain_of_fire Fluffy_Pillow 46945.5/50000: 94% mana
3.2/5: 64% soul_shard
bloodlust, decimating_bolt(2)
0:29.808 aoe K conflagrate Fluffy_Pillow 47449.5/50000: 95% mana
0.6/5: 12% soul_shard
bloodlust, decimating_bolt(2)
0:30.816 aoe L incinerate Fluffy_Pillow 47453.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.755 default A cataclysm Fluffy_Pillow 46923.0/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust, decimating_bolt
0:33.094 aoe L incinerate Fluffy_Pillow 47092.5/50000: 94% mana
2.3/5: 46% soul_shard
bloodlust, decimating_bolt
0:34.434 aoe K conflagrate Fluffy_Pillow 46762.5/50000: 94% mana
3.0/5: 60% soul_shard
bloodlust
0:35.439 aoe H havoc enemy2 46765.0/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:36.444 havoc Q chaos_bolt Fluffy_Pillow 46267.5/50000: 93% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:37.851 havoc Q chaos_bolt Fluffy_Pillow 46971.0/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:39.859 havoc R incinerate Fluffy_Pillow 47975.0/50000: 96% mana
0.6/5: 12% soul_shard
bloodlust
0:41.199 havoc N conflagrate Fluffy_Pillow 47645.0/50000: 95% mana
1.1/5: 22% soul_shard
0:42.505 havoc P immolate Fluffy_Pillow 47798.0/50000: 96% mana
2.6/5: 52% soul_shard
backdraft
0:43.810 havoc Q chaos_bolt Fluffy_Pillow 47700.5/50000: 95% mana
2.6/5: 52% soul_shard
backdraft
0:45.637 havoc R incinerate Fluffy_Pillow 48614.0/50000: 97% mana
1.0/5: 20% soul_shard
0:47.377 default 9 soul_fire Fluffy_Pillow 48484.0/50000: 97% mana
1.7/5: 34% soul_shard
0:50.855 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
0:53.696 aoe F immolate enemy3 49673.0/50000: 99% mana
3.6/5: 72% soul_shard
0:55.002 aoe F immolate enemy2 49252.0/50000: 99% mana
3.8/5: 76% soul_shard
0:56.309 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.9/5: 78% soul_shard
0:57.615 aoe K conflagrate Fluffy_Pillow 49808.5/50000: 100% mana
1.2/5: 24% soul_shard
0:58.924 aoe L incinerate Fluffy_Pillow 49963.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
1:00.144 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:01.450 aoe L incinerate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:02.669 aoe I rain_of_fire Fluffy_Pillow 48765.0/50000: 98% mana
3.3/5: 66% soul_shard
1:03.976 default A cataclysm Fluffy_Pillow 49418.5/50000: 99% mana
0.4/5: 8% soul_shard
1:05.717 aoe H havoc enemy2 49502.5/50000: 99% mana
0.7/5: 14% soul_shard
1:07.024 havoc R incinerate Fluffy_Pillow 49156.0/50000: 98% mana
0.7/5: 14% soul_shard
1:08.765 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:10.071 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:11.898 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:13.640 havoc R incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.5/5: 30% soul_shard
1:15.380 havoc P immolate Fluffy_Pillow 48873.0/50000: 98% mana
2.0/5: 40% soul_shard
1:16.687 havoc N conflagrate Fluffy_Pillow 48776.5/50000: 98% mana
2.2/5: 44% soul_shard
1:17.994 aoe E channel_demonfire Fluffy_Pillow 48930.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:20.902 aoe I rain_of_fire Fluffy_Pillow 49634.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:22.209 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
1:24.384 aoe F immolate enemy3 48002.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft
1:25.691 aoe L incinerate Fluffy_Pillow 47905.5/50000: 96% mana
1.2/5: 24% soul_shard
backdraft
1:26.911 aoe K conflagrate Fluffy_Pillow 47515.5/50000: 95% mana
1.6/5: 32% soul_shard
decimating_bolt(2)
1:28.218 aoe L incinerate Fluffy_Pillow 47669.0/50000: 95% mana
2.2/5: 44% soul_shard
backdraft, decimating_bolt(2)
1:29.439 aoe L incinerate Fluffy_Pillow 47279.5/50000: 95% mana
2.6/5: 52% soul_shard
decimating_bolt
1:31.180 aoe L incinerate Fluffy_Pillow 47150.0/50000: 94% mana
2.9/5: 58% soul_shard
1:32.919 aoe I rain_of_fire Fluffy_Pillow 47019.5/50000: 94% mana
3.4/5: 68% soul_shard
1:34.225 aoe K conflagrate Fluffy_Pillow 47672.5/50000: 95% mana
0.6/5: 12% soul_shard
1:35.533 default A cataclysm Fluffy_Pillow 47826.5/50000: 96% mana
1.3/5: 26% soul_shard
backdraft
1:37.451 default 9 soul_fire Fluffy_Pillow 48285.5/50000: 97% mana
1.6/5: 32% soul_shard
backdraft
1:40.929 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:43.839 aoe H havoc enemy2 49707.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
1:45.146 havoc N conflagrate Fluffy_Pillow 49361.0/50000: 99% mana
3.6/5: 72% soul_shard
1:46.452 havoc Q chaos_bolt Fluffy_Pillow 49514.0/50000: 99% mana
4.7/5: 94% soul_shard
backdraft
1:48.279 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
1:50.888 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:52.193 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
backdraft
1:53.501 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
1:55.327 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:57.066 aoe F immolate enemy3 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
1:58.372 aoe L incinerate Fluffy_Pillow 48904.5/50000: 98% mana
1.2/5: 24% soul_shard
2:00.113 aoe K conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
1.8/5: 36% soul_shard
2:01.420 aoe L incinerate Fluffy_Pillow 48928.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:02.640 aoe E channel_demonfire Fluffy_Pillow 48538.5/50000: 97% mana
2.8/5: 56% soul_shard
2:05.451 aoe F immolate enemy2 49194.0/50000: 98% mana
3.1/5: 62% soul_shard
2:06.758 aoe I rain_of_fire Fluffy_Pillow 49097.5/50000: 98% mana
3.2/5: 64% soul_shard
2:08.063 default A cataclysm Fluffy_Pillow 49750.0/50000: 100% mana
0.4/5: 8% soul_shard
2:09.804 aoe J decimating_bolt Fluffy_Pillow 49502.5/50000: 99% mana
0.7/5: 14% soul_shard
2:11.979 aoe K conflagrate Fluffy_Pillow 48002.0/50000: 96% mana
0.9/5: 18% soul_shard
2:13.288 aoe L incinerate Fluffy_Pillow 48156.5/50000: 96% mana
1.6/5: 32% soul_shard
backdraft
2:14.508 aoe H havoc enemy2 47766.5/50000: 96% mana
1.8/5: 36% soul_shard
decimating_bolt(2)
2:15.814 havoc Q chaos_bolt Fluffy_Pillow 47419.5/50000: 95% mana
2.1/5: 42% soul_shard
decimating_bolt(2)
2:18.424 havoc R incinerate Fluffy_Pillow 48724.5/50000: 97% mana
0.5/5: 10% soul_shard
decimating_bolt(2)
2:20.163 havoc N conflagrate Fluffy_Pillow 48594.0/50000: 97% mana
1.1/5: 22% soul_shard
decimating_bolt
2:21.469 havoc P immolate Fluffy_Pillow 48747.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft, decimating_bolt
2:22.774 havoc Q chaos_bolt Fluffy_Pillow 48649.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft, decimating_bolt
2:24.602 havoc R incinerate Fluffy_Pillow 49563.5/50000: 99% mana
0.6/5: 12% soul_shard
decimating_bolt
2:26.343 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:27.650 default 9 soul_fire Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:31.128 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
2:33.857 aoe F immolate enemy3 49617.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
2:35.163 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
2:36.470 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
1.5/5: 30% soul_shard
2:37.776 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
2:38.996 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
2:40.735 default A cataclysm Fluffy_Pillow 48872.0/50000: 98% mana
2.9/5: 58% soul_shard
2:42.475 aoe I rain_of_fire Fluffy_Pillow 49242.0/50000: 98% mana
3.1/5: 62% soul_shard
2:43.781 aoe K conflagrate Fluffy_Pillow 49895.0/50000: 100% mana
0.4/5: 8% soul_shard
2:45.088 aoe H havoc enemy2 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
2:46.395 havoc R incinerate Fluffy_Pillow 49653.5/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
2:47.614 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
2:49.354 havoc Q chaos_bolt Fluffy_Pillow 48872.0/50000: 98% mana
2.3/5: 46% soul_shard
2:51.962 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
2:53.702 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:55.010 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:56.316 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:59.046 aoe I rain_of_fire Fluffy_Pillow 49674.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
3:00.353 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
3:02.529 aoe F immolate enemy3 48002.5/50000: 96% mana
0.5/5: 10% soul_shard
backdraft
3:03.835 cds M summon_infernal Fluffy_Pillow 47905.5/50000: 96% mana
0.6/5: 12% soul_shard
3:05.143 aoe K conflagrate Fluffy_Pillow 47559.5/50000: 95% mana
1.0/5: 20% soul_shard
decimating_bolt(3)
3:06.451 aoe L incinerate Fluffy_Pillow 47713.5/50000: 95% mana
2.0/5: 40% soul_shard
backdraft, decimating_bolt(3)
3:07.669 aoe L incinerate Fluffy_Pillow 47322.5/50000: 95% mana
2.6/5: 52% soul_shard
decimating_bolt(2)
3:09.410 aoe D rain_of_fire Fluffy_Pillow 47193.0/50000: 94% mana
3.4/5: 68% soul_shard
decimating_bolt
3:10.715 aoe K conflagrate Fluffy_Pillow 47845.5/50000: 96% mana
0.7/5: 14% soul_shard
decimating_bolt
3:12.023 aoe L incinerate Fluffy_Pillow 47999.5/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt
3:13.242 default A cataclysm Fluffy_Pillow 47609.0/50000: 95% mana
2.2/5: 44% soul_shard
3:14.982 aoe D rain_of_fire Fluffy_Pillow 47979.0/50000: 96% mana
3.0/5: 60% soul_shard
3:16.289 default 9 soul_fire Fluffy_Pillow 48632.5/50000: 97% mana
0.2/5: 4% soul_shard
3:19.768 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.3/5: 46% soul_shard
3:22.479 aoe H havoc enemy2 49608.5/50000: 99% mana
3.2/5: 64% soul_shard
3:23.786 havoc N conflagrate Fluffy_Pillow 49262.0/50000: 99% mana
3.7/5: 74% soul_shard
3:25.092 havoc Q chaos_bolt Fluffy_Pillow 49415.0/50000: 99% mana
5.0/5: 100% soul_shard
backdraft
3:26.921 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.228 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:30.054 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.662 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
3:33.968 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
3:35.332 aoe F immolate enemy3 49434.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
3:36.638 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
3:37.946 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
3:39.166 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
3:40.907 aoe L incinerate Fluffy_Pillow 48873.0/50000: 98% mana
1.2/5: 24% soul_shard
3:42.645 aoe E channel_demonfire Fluffy_Pillow 48742.0/50000: 97% mana
1.6/5: 32% soul_shard
3:45.506 default A cataclysm Fluffy_Pillow 49422.5/50000: 99% mana
2.3/5: 46% soul_shard
3:47.249 aoe K conflagrate Fluffy_Pillow 49503.5/50000: 99% mana
2.5/5: 50% soul_shard
3:48.556 aoe I rain_of_fire Fluffy_Pillow 49657.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
3:49.862 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
3:52.038 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
0.5/5: 10% soul_shard
backdraft
3:53.257 aoe H havoc enemy2 47612.0/50000: 95% mana
0.8/5: 16% soul_shard
3:54.563 havoc R incinerate Fluffy_Pillow 47265.0/50000: 95% mana
1.0/5: 20% soul_shard
decimating_bolt(3)
3:56.305 havoc N conflagrate Fluffy_Pillow 47136.0/50000: 94% mana
1.7/5: 34% soul_shard
decimating_bolt(2)
3:57.610 havoc P immolate Fluffy_Pillow 47288.5/50000: 95% mana
2.8/5: 56% soul_shard
backdraft, decimating_bolt(2)
3:58.917 havoc Q chaos_bolt Fluffy_Pillow 47192.0/50000: 94% mana
3.1/5: 62% soul_shard
backdraft, decimating_bolt(2)
4:00.746 havoc N conflagrate Fluffy_Pillow 48106.5/50000: 96% mana
1.3/5: 26% soul_shard
decimating_bolt(2)
4:02.053 havoc Q chaos_bolt Fluffy_Pillow 48260.0/50000: 97% mana
2.5/5: 50% soul_shard
backdraft, decimating_bolt(2)
4:03.882 aoe L incinerate Fluffy_Pillow 49174.5/50000: 98% mana
0.7/5: 14% soul_shard
decimating_bolt(2)
4:05.623 default 9 soul_fire Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
decimating_bolt
4:09.100 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
decimating_bolt
4:11.999 aoe F immolate enemy3 49701.5/50000: 99% mana
2.8/5: 56% soul_shard
decimating_bolt
4:13.306 aoe F immolate enemy2 49252.5/50000: 99% mana
3.0/5: 60% soul_shard
decimating_bolt
4:14.614 aoe I rain_of_fire Fluffy_Pillow 49156.5/50000: 98% mana
3.0/5: 60% soul_shard
decimating_bolt
4:15.920 aoe K conflagrate Fluffy_Pillow 49809.5/50000: 100% mana
0.3/5: 6% soul_shard
decimating_bolt
4:17.228 default A cataclysm Fluffy_Pillow 49963.5/50000: 100% mana
0.9/5: 18% soul_shard
backdraft, decimating_bolt
4:18.982 aoe L incinerate Fluffy_Pillow 49502.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft, decimating_bolt
4:20.201 aoe K conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
4:21.509 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:22.727 aoe L incinerate Fluffy_Pillow 48765.0/50000: 98% mana
2.8/5: 56% soul_shard
4:24.469 aoe H havoc enemy2 48636.0/50000: 97% mana
3.1/5: 62% soul_shard
4:25.775 havoc N conflagrate Fluffy_Pillow 48289.0/50000: 97% mana
3.3/5: 66% soul_shard
4:27.226 havoc Q chaos_bolt Fluffy_Pillow 48514.5/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
4:29.055 havoc Q chaos_bolt Fluffy_Pillow 49429.0/50000: 99% mana
2.8/5: 56% soul_shard
4:31.664 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
4:32.970 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.2/5: 24% soul_shard
4:34.710 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
4:36.016 aoe E channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:38.821 aoe F immolate enemy3 49807.5/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
4:40.129 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:41.436 aoe J decimating_bolt Fluffy_Pillow 49906.5/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
4:43.611 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
1.0/5: 20% soul_shard
backdraft
4:44.830 aoe K conflagrate Fluffy_Pillow 47611.5/50000: 95% mana
1.4/5: 28% soul_shard
4:46.137 aoe L incinerate Fluffy_Pillow 47765.0/50000: 96% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(3)
4:47.356 aoe L incinerate Fluffy_Pillow 47374.5/50000: 95% mana
2.4/5: 48% soul_shard
decimating_bolt(2)
4:49.097 default A cataclysm Fluffy_Pillow 47245.0/50000: 94% mana
2.9/5: 58% soul_shard
decimating_bolt
4:50.838 aoe I rain_of_fire Fluffy_Pillow 47615.5/50000: 95% mana
3.2/5: 64% soul_shard
decimating_bolt
4:52.144 aoe K conflagrate Fluffy_Pillow 48268.5/50000: 97% mana
0.2/5: 4% soul_shard
decimating_bolt
4:53.452 aoe L incinerate Fluffy_Pillow 48422.5/50000: 97% mana
1.0/5: 20% soul_shard
backdraft, decimating_bolt
4:54.673 default 9 soul_fire Fluffy_Pillow 48033.0/50000: 96% mana
1.2/5: 24% soul_shard
4:58.150 aoe E channel_demonfire Fluffy_Pillow 48771.5/50000: 98% mana
2.7/5: 54% soul_shard
5:01.043 aoe H havoc enemy2 49468.0/50000: 99% mana
3.0/5: 60% soul_shard
5:02.350 havoc N conflagrate Fluffy_Pillow 49121.5/50000: 98% mana
3.2/5: 64% soul_shard
5:03.657 havoc Q chaos_bolt Fluffy_Pillow 49275.0/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
5:05.483 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
5:08.093 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
5:09.835 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.4/5: 28% soul_shard
5:11.142 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
5:12.448 aoe F immolate enemy3 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
5:13.755 aoe L incinerate Fluffy_Pillow 48963.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
5:14.975 aoe I rain_of_fire Fluffy_Pillow 48573.0/50000: 97% mana
3.1/5: 62% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necro_FatalDec"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=218:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Necro_InfernalBrand : 9572 dps, 5306 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9571.8 9571.8 17.3 / 0.180% 815.3 / 8.5% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
405.7 402.2 Mana 0.00% 37.7 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necro_InfernalBrand 9572
Cataclysm 772 8.1% 9.6 32.57sec 23970 14111 Direct 28.7 6701 13398 7990 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 28.72 0.00 0.00 1.6987 0.0000 229498.37 229498.37 0.00% 14110.82 14110.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 23.20 14 33 6700.96 6141 7261 6701.33 6514 6919 155440 155440 0.00%
crit 19.24% 5.53 0 12 13397.50 12283 14521 13289.00 0 14409 74058 74058 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.65
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1018) 0.0% (10.6%) 12.0 26.04sec 25183 9362

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.02 0.00 179.25 0.00 2.6900 0.1633 0.00 0.00 0.00% 9361.51 9361.51

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.02
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1018 10.6% 0.0 0.00sec 0 0 Direct 537.8 471 944 563 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 537.76 0.00 0.00 0.0000 0.0000 302601.50 302601.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 433.74 317 575 471.43 263 976 471.79 442 492 204483 204483 0.00%
crit 19.34% 104.02 63 146 943.50 525 1952 944.23 812 1076 98118 98118 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1281 (1749) 13.4% (18.3%) 22.4 12.78sec 23154 11683 Direct 44.6 (88.7) 0 8529 8529 100.0% (60.0%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.43 44.60 0.00 0.00 1.9819 0.0000 380405.28 380405.28 0.00% 11683.21 11683.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.60 32 58 8529.09 5861 11548 8528.97 8359 8684 380405 380405 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.52
  • if_expr:cast_time<havoc_remains
    Internal Combustion 468 4.9% 44.1 12.79sec 3147 0 Direct 44.1 2633 5257 3147 19.6%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.14 44.14 0.00 0.00 0.0000 0.0000 138913.48 138913.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 35.50 23 50 2633.23 57 3715 2635.92 2473 2823 93486 93486 0.00%
crit 19.58% 8.64 2 18 5256.88 7 7428 5275.07 3527 6350 45427 45427 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 820 8.6% 36.7 7.95sec 6637 5313 Direct 56.6 3608 7236 4306 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.71 56.63 0.00 0.00 1.2493 0.0000 243681.49 243681.49 0.00% 5312.90 5312.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 45.77 33 61 3607.72 2047 5042 3608.32 3334 3884 165136 165136 0.00%
crit 19.17% 10.86 1 21 7235.61 4095 10084 7224.34 5388 9213 78546 78546 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [K]:16.84
  • if_expr:buff.backdraft.down
    havoc
    [N]:19.86
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Decimating Bolt 0 (99) 0.0% (1.0%) 5.0 61.77sec 5964 2875

Stats Details: Decimating Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.97 0.00 0.00 0.00 2.0748 0.0000 0.00 0.00 0.00% 2874.89 2874.89

Action Details: Decimating Bolt

  • id:325289
  • school:shadow
  • range:40.0
  • travel_speed:25.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:325289
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.

Action Priority List

    aoe
    [J]:5.01
  • if_expr:(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
    Decimating Bolt (_tick_t) 99 1.0% 0.0 0.00sec 0 0 Direct 19.8 1259 2504 1499 19.4%

Stats Details: Decimating Bolt Tick T

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 19.77 0.00 0.00 0.0000 0.0000 29657.40 29657.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 15.93 7 26 1259.07 900 1674 1255.95 1125 1412 20056 20056 0.00%
crit 19.40% 3.83 0 12 2504.36 1799 3347 2436.46 0 3189 9602 9602 0.00%

Action Details: Decimating Bolt Tick T

  • id:327059
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:327059
  • name:Decimating Bolt
  • school:shadow
  • tooltip:
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
Immolate 1606 16.8% 26.9 10.55sec 17769 14082 Direct 34.4 1538 3080 1837 19.4%
Periodic 343.1 1014 2028 1209 19.2% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.89 34.36 343.12 343.12 1.2619 2.4816 477716.99 477716.99 0.00% 539.55 14081.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 27.70 18 40 1537.67 819 2017 1538.03 1420 1644 42599 42599 0.00%
crit 19.37% 6.66 0 15 3079.67 1665 4034 3077.31 0 3913 20493 20493 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.80% 277.26 213 348 1013.70 1 1261 1013.82 995 1032 281055 281055 0.00%
crit 19.20% 65.86 38 97 2027.74 12 2521 2028.08 1903 2125 133570 133570 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:18.27
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.71
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 758 7.9% 40.4 6.71sec 5590 3802 Direct 49.6 (49.6) 3837 7595 4552 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.41 49.65 0.00 0.00 1.4703 0.0000 225932.48 225932.48 0.00% 3802.17 3802.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 40.22 22 57 3836.89 1312 8330 3844.71 3132 4797 154291 154291 0.00%
crit 18.99% 9.43 2 21 7594.75 2625 16621 7593.52 3904 12806 71642 71642 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:31.05
    havoc
    [R]:9.63
  • if_expr:cast_time<havoc_remains
Rain of Fire 863 9.0% 16.4 17.35sec 15664 12523 Periodic 388.1 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.35 0.00 0.00 388.07 1.2509 0.0000 256180.63 256180.63 0.00% 12522.88 12522.88
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.60% 312.79 205 436 552.96 507 599 552.95 546 561 172958 172958 0.00%
crit 19.40% 75.27 35 109 1105.64 1013 1198 1105.58 1086 1127 83223 83223 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.04
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.32
Soul Fire 509 5.3% 5.5 49.40sec 27280 7845 Direct 7.4 17056 34257 20317 19.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.54 7.44 0.00 0.00 3.4775 0.0000 151142.61 151142.61 0.00% 7845.04 7845.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.01% 6.03 2 9 17056.48 8615 21177 17062.44 13593 20313 102781 102781 0.00%
crit 18.99% 1.41 0 5 34257.10 17326 42348 26229.72 0 42348 48362 48362 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.68
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:0.95
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.59sec 11876 10269 Direct 6.0 3348 6696 3967 18.2%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23751.17 23751.17 0.00% 10268.56 10268.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.77% 4.91 1 6 3348.13 3348 3348 3348.13 3348 3348 16426 16426 0.00%
crit 18.23% 1.09 0 5 6696.27 6696 6696 4713.39 0 6696 7325 7325 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3832 / 783
Immolation 3567 7.5% 39.0 5.49sec 5489 0 Direct 117.0 1529 3059 1830 19.6%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 214056.87 214056.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.36% 94.02 81 105 1529.10 1395 2023 1529.17 1492 1556 143775 143775 0.00%
crit 19.64% 22.98 12 36 3059.22 2790 4046 3058.32 2803 3408 70282 70282 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 387 269 Direct 41.0 326 651 387 18.9%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15874.09 22674.56 29.99% 269.49 269.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.07% 33.24 23 40 325.55 326 326 325.55 326 326 10821 15457 29.99%
crit 18.93% 7.76 1 18 651.10 651 651 651.10 651 651 5053 7218 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1651 1134 Direct 91.9 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152903.13 152903.13 0.00% 1134.37 1134.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 74.14 54 101 1395.06 1395 1395 1395.06 1395 1395 103435 103435 0.00%
crit 19.30% 17.73 7 35 2790.11 2790 2790 2790.11 2790 2790 49468 49468 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Necro_InfernalBrand
Havoc 9.5 32.31sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.51 0.00 0.00 0.00 1.2434 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.51
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.7 0.0 8.0sec 8.0sec 4.3sec 52.53% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:52.53%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Decimating Bolt 4.9 0.0 61.0sec 61.0sec 9.9sec 16.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_decimating_bolt
  • max_stacks:3
  • base duration:45.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.60
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:47.2s / 73.4s
  • trigger_min/max:47.2s / 73.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.8s

Stack Uptimes

  • decimating_bolt_1:6.54%
  • decimating_bolt_2:5.92%
  • decimating_bolt_3:3.88%

Spelldata

  • id:325299
  • name:Decimating Bolt
  • tooltip:Damage of {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044&!s137046[Demonbolt][Shadow Bolt] increased by $w2%.
  • description:{$@spelldesc325289=Hurl bolts of decimating magic at your target, dealing $<damage> Shadow damage and increasing the damage of your next{$?s198590=false}[][ {$325299u=3}] {$?s137046=false}[Incinerates]?s198590[Drain Soul]?a137044&?!s137046[Demonbolts]?!a137044[Shadow Bolts][] by {$325299s1=100}%.$?a196408[ This value is reduced while using Fire and Brimstone.][] Decimating Bolt's damage, and the bonus to {$?s137046=false}[Incinerate]?s198590[Drain Soul]?a137044[Demonbolt]?!s137046&!a137044[Shadow Bolt][] both increase as your target's health decreases.}
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
infernal - infernal: Embers 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Necro_InfernalBrand_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.7sec 180.7sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Necro_InfernalBrand_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.12% 8.69% 14.73% 0.9s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necro_InfernalBrand
soul_fire Soul Shard 6.55 7.32 7.85% 1.12 0.18 2.45%
immolate Soul Shard 343.21 33.00 35.41% 0.10 1.32 3.85%
incinerate Soul Shard 40.46 10.00 10.74% 0.25 0.00 0.01%
conflagrate Soul Shard 36.70 28.29 30.36% 0.77 0.00 0.00%
mana_regen Mana 661.09 119729.90 100.00% 181.11 28806.33 19.39%
immolate_crits Soul Shard 32.96 3.17 3.40% 0.10 0.13 3.79%
incinerate_crits Soul Shard 9.46 0.95 1.01% 0.10 0.00 0.03%
infernal Soul Shard 120.00 10.46 11.23% 0.09 1.54 12.82%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 402.18 405.72 28828.7 48944.9 46764.5 50000.0
Soul Shard 4.0 0.31 0.32 3.2 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Necro_InfernalBrand
cataclysm Mana 9.6 4791.8 500.0 500.5 47.9
channel_demonfire Mana 12.0 9016.6 750.0 750.4 33.6
chaos_bolt Soul Shard 22.4 44.8 2.0 2.0 11589.2
conflagrate Mana 36.7 18349.4 500.0 499.8 13.3
decimating_bolt Mana 5.0 9949.5 2000.0 2000.9 3.0
havoc Mana 9.5 9512.6 1000.0 1000.3 0.0
immolate Mana 26.9 20155.4 750.0 749.7 23.7
incinerate Mana 40.5 40462.1 1000.0 1001.2 5.6
rain_of_fire Soul Shard 16.4 49.1 3.0 3.0 5220.3
soul_fire Mana 6.6 6552.1 1000.0 1182.6 23.1
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Necro_InfernalBrand Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Necro_InfernalBrand Damage Per Second
Count 618
Mean 9571.83
Minimum 9087.69
Maximum 10197.10
Spread ( max - min ) 1109.41
Range [ ( max - min ) / 2 * 100% ] 5.80%
Standard Deviation 218.8608
5th Percentile 9231.92
95th Percentile 9958.74
( 95th Percentile - 5th Percentile ) 726.82
Mean Distribution
Standard Deviation 8.8039
95.00% Confidence Interval ( 9554.57 - 9589.08 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2009
0.1 Scale Factor Error with Delta=300 409
0.05 Scale Factor Error with Delta=300 1636
0.01 Scale Factor Error with Delta=300 40891
Priority Target DPS
Necro_InfernalBrand Priority Target Damage Per Second
Count 618
Mean 5306.23
Minimum 4970.95
Maximum 5773.09
Spread ( max - min ) 802.14
Range [ ( max - min ) / 2 * 100% ] 7.56%
Standard Deviation 131.1201
5th Percentile 5102.85
95th Percentile 5520.50
( 95th Percentile - 5th Percentile ) 417.65
Mean Distribution
Standard Deviation 5.2744
95.00% Confidence Interval ( 5295.89 - 5316.56 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2346
0.1 Scale Factor Error with Delta=300 147
0.05 Scale Factor Error with Delta=300 588
0.01 Scale Factor Error with Delta=300 14677
DPS(e)
Necro_InfernalBrand Damage Per Second (Effective)
Count 618
Mean 9571.83
Minimum 9087.69
Maximum 10197.10
Spread ( max - min ) 1109.41
Range [ ( max - min ) / 2 * 100% ] 5.80%
Damage
Necro_InfernalBrand Damage
Count 618
Mean 2459481.40
Minimum 1966478.59
Maximum 3030671.23
Spread ( max - min ) 1064192.64
Range [ ( max - min ) / 2 * 100% ] 21.63%
DTPS
Necro_InfernalBrand Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necro_InfernalBrand Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necro_InfernalBrand Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necro_InfernalBrand Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necro_InfernalBrand Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necro_InfernalBrand Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necro_InfernalBrandTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necro_InfernalBrand Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.68 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.65 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.04 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.02 channel_demonfire,if=dot.immolate.remains>cast_time
F 18.27 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.51 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.32 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
J 5.01 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
K 16.84 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 31.05 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 19.86 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 0.95 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.71 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.52 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 9.63 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDJKLKDLLALEHNQQNOFFILFKEILKLALHNQQRNPEIJFKLLLL9AHQNQNQPNEILLFFFKLLIKAHRRNQRQP9EFFIJKLKLAHNQQRNPELIKLFMLKDLL9AEHQNQNPQDJKFLEFFKIALHNQRRNPR9EFIKLILKLAHQRNQRPNEIJFLKLLFLIA9EHNQNQRNPLF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.953 cds M summon_infernal Fluffy_Pillow 49726.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust
0:04.959 aoe H havoc enemy2 49229.5/50000: 98% mana
4.6/5: 92% soul_shard
bloodlust
0:05.965 havoc Q chaos_bolt Fluffy_Pillow 48732.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.975 havoc N conflagrate Fluffy_Pillow 49737.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.982 havoc Q chaos_bolt Fluffy_Pillow 49741.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.388 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.394 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.400 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.806 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.813 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.219 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.226 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.233 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.731 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.738 aoe F immolate enemy2 49252.5/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:22.746 aoe F immolate enemy3 49006.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.753 aoe D rain_of_fire Fluffy_Pillow 48760.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.759 aoe J decimating_bolt Fluffy_Pillow 49263.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.434 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust
0:27.440 aoe L incinerate Fluffy_Pillow 48005.5/50000: 96% mana
1.8/5: 36% soul_shard
bloodlust, backdraft
0:28.380 aoe K conflagrate Fluffy_Pillow 47475.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, decimating_bolt(2)
0:29.387 aoe D rain_of_fire Fluffy_Pillow 47479.0/50000: 95% mana
3.2/5: 64% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:30.393 aoe L incinerate Fluffy_Pillow 47982.0/50000: 96% mana
0.8/5: 16% soul_shard
bloodlust, backdraft, decimating_bolt(2)
0:31.332 aoe L incinerate Fluffy_Pillow 47451.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust, decimating_bolt
0:32.672 default A cataclysm Fluffy_Pillow 47121.5/50000: 94% mana
2.1/5: 42% soul_shard
bloodlust
0:34.013 aoe L incinerate Fluffy_Pillow 47292.0/50000: 95% mana
2.7/5: 54% soul_shard
bloodlust
0:35.354 aoe E channel_demonfire Fluffy_Pillow 46962.5/50000: 94% mana
3.0/5: 60% soul_shard
bloodlust
0:37.590 aoe H havoc enemy2 47330.5/50000: 95% mana
3.4/5: 68% soul_shard
bloodlust
0:38.597 havoc N conflagrate Fluffy_Pillow 46834.0/50000: 94% mana
3.6/5: 72% soul_shard
bloodlust
0:39.604 havoc Q chaos_bolt Fluffy_Pillow 46837.5/50000: 94% mana
4.7/5: 94% soul_shard
bloodlust, backdraft
0:41.009 havoc Q chaos_bolt Fluffy_Pillow 47540.0/50000: 95% mana
3.0/5: 60% soul_shard
0:43.619 havoc N conflagrate Fluffy_Pillow 48845.0/50000: 98% mana
1.3/5: 26% soul_shard
0:44.926 havoc O soul_fire Fluffy_Pillow 48998.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
0:48.478 aoe F immolate enemy2 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:49.785 aoe F immolate Fluffy_Pillow 48906.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.093 aoe I rain_of_fire Fluffy_Pillow 48810.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.402 aoe L incinerate Fluffy_Pillow 49464.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
0:53.621 aoe F immolate enemy3 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
0:54.927 aoe K conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.6/5: 52% soul_shard
0:56.233 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
0:59.065 aoe I rain_of_fire Fluffy_Pillow 49724.0/50000: 99% mana
3.7/5: 74% soul_shard
backdraft
1:00.372 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
1:01.592 aoe K conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
1:02.899 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
1:04.119 default A cataclysm Fluffy_Pillow 48766.0/50000: 98% mana
2.2/5: 44% soul_shard
1:05.859 aoe L incinerate Fluffy_Pillow 49136.0/50000: 98% mana
2.5/5: 50% soul_shard
1:07.600 aoe H havoc enemy2 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
1:08.905 havoc N conflagrate Fluffy_Pillow 48655.0/50000: 97% mana
3.0/5: 60% soul_shard
1:10.212 havoc Q chaos_bolt Fluffy_Pillow 48808.5/50000: 98% mana
4.0/5: 80% soul_shard
backdraft
1:12.039 havoc Q chaos_bolt Fluffy_Pillow 49722.0/50000: 99% mana
2.3/5: 46% soul_shard
1:14.647 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:16.388 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
1:17.694 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
1:19.002 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:21.837 aoe I rain_of_fire Fluffy_Pillow 49727.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:23.145 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.0/5: 0% soul_shard
backdraft
1:25.321 aoe F immolate enemy3 48002.5/50000: 96% mana
0.3/5: 6% soul_shard
backdraft
1:26.629 aoe K conflagrate Fluffy_Pillow 47906.5/50000: 96% mana
0.6/5: 12% soul_shard
1:27.936 aoe L incinerate Fluffy_Pillow 48060.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft, decimating_bolt(3)
1:29.156 aoe L incinerate Fluffy_Pillow 47670.0/50000: 95% mana
1.6/5: 32% soul_shard
decimating_bolt(2)
1:30.897 aoe L incinerate Fluffy_Pillow 47540.5/50000: 95% mana
1.9/5: 38% soul_shard
decimating_bolt
1:32.637 aoe L incinerate Fluffy_Pillow 47410.5/50000: 95% mana
2.6/5: 52% soul_shard
1:34.378 default 9 soul_fire Fluffy_Pillow 47281.0/50000: 95% mana
3.0/5: 60% soul_shard
1:37.856 default A cataclysm Fluffy_Pillow 48020.0/50000: 96% mana
4.6/5: 92% soul_shard
1:39.599 aoe H havoc enemy2 48391.5/50000: 97% mana
4.7/5: 94% soul_shard
1:40.904 havoc Q chaos_bolt Fluffy_Pillow 48044.0/50000: 96% mana
4.7/5: 94% soul_shard
1:43.513 havoc N conflagrate Fluffy_Pillow 49348.5/50000: 99% mana
3.0/5: 60% soul_shard
1:44.819 havoc Q chaos_bolt Fluffy_Pillow 49501.5/50000: 99% mana
4.3/5: 86% soul_shard
backdraft
1:46.648 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:47.956 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:49.783 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:51.088 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
1.9/5: 38% soul_shard
1:52.395 aoe E channel_demonfire Fluffy_Pillow 49405.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
1:55.307 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:56.613 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:57.831 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
1:59.571 aoe F immolate enemy3 48871.5/50000: 98% mana
1.2/5: 24% soul_shard
2:00.876 aoe F immolate enemy2 48774.0/50000: 98% mana
1.4/5: 28% soul_shard
2:02.182 aoe F immolate Fluffy_Pillow 48677.0/50000: 97% mana
1.5/5: 30% soul_shard
2:03.489 aoe K conflagrate Fluffy_Pillow 48580.5/50000: 97% mana
1.7/5: 34% soul_shard
2:04.795 aoe L incinerate Fluffy_Pillow 48733.5/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
2:06.012 aoe L incinerate Fluffy_Pillow 48342.0/50000: 97% mana
2.7/5: 54% soul_shard
2:07.751 aoe I rain_of_fire Fluffy_Pillow 48211.5/50000: 96% mana
3.2/5: 64% soul_shard
2:09.057 aoe K conflagrate Fluffy_Pillow 48864.5/50000: 98% mana
0.3/5: 6% soul_shard
2:10.363 default A cataclysm Fluffy_Pillow 49017.5/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
2:12.102 aoe H havoc enemy2 49387.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
2:13.407 havoc R incinerate Fluffy_Pillow 49039.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
2:14.624 havoc R incinerate Fluffy_Pillow 48648.0/50000: 97% mana
1.9/5: 38% soul_shard
2:16.363 havoc N conflagrate Fluffy_Pillow 48517.5/50000: 97% mana
2.6/5: 52% soul_shard
2:17.759 havoc Q chaos_bolt Fluffy_Pillow 48715.5/50000: 97% mana
3.7/5: 74% soul_shard
backdraft
2:19.587 havoc R incinerate Fluffy_Pillow 49629.5/50000: 99% mana
1.9/5: 38% soul_shard
2:21.327 havoc Q chaos_bolt Fluffy_Pillow 49002.0/50000: 98% mana
2.7/5: 54% soul_shard
2:23.937 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
2:25.244 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
1.2/5: 24% soul_shard
2:28.721 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
2:31.575 aoe F immolate enemy2 49679.0/50000: 99% mana
2.9/5: 58% soul_shard
2:32.882 aoe F immolate enemy3 49252.5/50000: 99% mana
3.0/5: 60% soul_shard
2:34.186 aoe I rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.1/5: 62% soul_shard
2:35.492 aoe J decimating_bolt Fluffy_Pillow 49807.5/50000: 100% mana
0.3/5: 6% soul_shard
2:37.668 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
0.5/5: 10% soul_shard
2:38.975 aoe L incinerate Fluffy_Pillow 48156.0/50000: 96% mana
1.1/5: 22% soul_shard
backdraft
2:40.195 aoe K conflagrate Fluffy_Pillow 47766.0/50000: 96% mana
1.5/5: 30% soul_shard
decimating_bolt(2)
2:41.502 aoe L incinerate Fluffy_Pillow 47919.5/50000: 96% mana
2.1/5: 42% soul_shard
backdraft, decimating_bolt(2)
2:42.721 default A cataclysm Fluffy_Pillow 47529.0/50000: 95% mana
2.5/5: 50% soul_shard
decimating_bolt
2:44.463 aoe H havoc enemy2 47900.0/50000: 96% mana
2.7/5: 54% soul_shard
decimating_bolt
2:45.770 havoc N conflagrate Fluffy_Pillow 47553.5/50000: 95% mana
2.8/5: 56% soul_shard
decimating_bolt
2:47.075 havoc Q chaos_bolt Fluffy_Pillow 47706.0/50000: 95% mana
4.0/5: 80% soul_shard
backdraft, decimating_bolt
2:48.904 havoc Q chaos_bolt Fluffy_Pillow 48620.5/50000: 97% mana
2.3/5: 46% soul_shard
decimating_bolt
2:51.514 havoc R incinerate Fluffy_Pillow 49925.5/50000: 100% mana
0.6/5: 12% soul_shard
decimating_bolt
2:53.255 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
2:54.562 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:55.869 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:58.801 aoe L incinerate Fluffy_Pillow 49775.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
3:00.021 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
3:01.326 aoe K conflagrate Fluffy_Pillow 49655.0/50000: 99% mana
0.3/5: 6% soul_shard
3:02.635 aoe L incinerate Fluffy_Pillow 49809.5/50000: 100% mana
1.0/5: 20% soul_shard
backdraft
3:03.854 aoe F immolate enemy3 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
3:05.161 cds M summon_infernal Fluffy_Pillow 48905.5/50000: 98% mana
1.6/5: 32% soul_shard
3:06.467 aoe L incinerate Fluffy_Pillow 48558.5/50000: 97% mana
1.9/5: 38% soul_shard
3:08.207 aoe K conflagrate Fluffy_Pillow 48428.5/50000: 97% mana
2.8/5: 56% soul_shard
3:09.653 aoe D rain_of_fire Fluffy_Pillow 48651.5/50000: 97% mana
3.7/5: 74% soul_shard
backdraft
3:10.960 aoe L incinerate Fluffy_Pillow 49305.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:12.179 aoe L incinerate Fluffy_Pillow 48914.5/50000: 98% mana
1.8/5: 36% soul_shard
3:13.919 default 9 soul_fire Fluffy_Pillow 48784.5/50000: 98% mana
2.6/5: 52% soul_shard
3:17.396 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.8/5: 96% soul_shard
3:19.136 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
3:21.952 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
3:23.259 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
3:25.870 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:27.177 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.7/5: 94% soul_shard
backdraft
3:29.002 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:30.308 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:31.616 havoc Q chaos_bolt Fluffy_Pillow 49253.0/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:33.443 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:34.749 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
3:36.925 aoe K conflagrate Fluffy_Pillow 48002.5/50000: 96% mana
0.9/5: 18% soul_shard
3:38.231 aoe F immolate enemy3 48155.5/50000: 96% mana
1.5/5: 30% soul_shard
backdraft
3:39.536 aoe L incinerate Fluffy_Pillow 48058.0/50000: 96% mana
1.7/5: 34% soul_shard
backdraft, decimating_bolt(3)
3:40.754 aoe E channel_demonfire Fluffy_Pillow 47667.0/50000: 95% mana
2.0/5: 40% soul_shard
decimating_bolt(2)
3:43.785 aoe F immolate Fluffy_Pillow 48432.5/50000: 97% mana
2.3/5: 46% soul_shard
decimating_bolt(2)
3:45.092 aoe F immolate enemy2 48336.0/50000: 97% mana
2.5/5: 50% soul_shard
decimating_bolt(2)
3:46.397 aoe K conflagrate Fluffy_Pillow 48238.5/50000: 96% mana
2.6/5: 52% soul_shard
decimating_bolt(2)
3:47.704 aoe I rain_of_fire Fluffy_Pillow 48392.0/50000: 97% mana
3.3/5: 66% soul_shard
backdraft, decimating_bolt(2)
3:49.012 default A cataclysm Fluffy_Pillow 49046.0/50000: 98% mana
0.5/5: 10% soul_shard
backdraft, decimating_bolt(2)
3:50.872 aoe L incinerate Fluffy_Pillow 49476.0/50000: 99% mana
0.7/5: 14% soul_shard
backdraft, decimating_bolt(2)
3:52.090 aoe H havoc enemy2 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
decimating_bolt
3:53.396 havoc N conflagrate Fluffy_Pillow 48654.5/50000: 97% mana
1.2/5: 24% soul_shard
decimating_bolt
3:54.702 havoc Q chaos_bolt Fluffy_Pillow 48807.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft, decimating_bolt
3:56.531 havoc R incinerate Fluffy_Pillow 49722.0/50000: 99% mana
0.6/5: 12% soul_shard
decimating_bolt
3:58.273 havoc R incinerate Fluffy_Pillow 49003.0/50000: 98% mana
1.3/5: 26% soul_shard
4:00.013 havoc N conflagrate Fluffy_Pillow 48873.0/50000: 98% mana
2.1/5: 42% soul_shard
4:01.548 havoc P immolate Fluffy_Pillow 49140.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:02.853 havoc R incinerate Fluffy_Pillow 49043.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
4:04.071 default 9 soul_fire Fluffy_Pillow 48652.0/50000: 97% mana
3.9/5: 78% soul_shard
4:07.548 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
4:10.448 aoe F immolate enemy3 49702.0/50000: 99% mana
5.0/5: 100% soul_shard
4:11.754 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
5.0/5: 100% soul_shard
4:13.061 aoe K conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
2.2/5: 44% soul_shard
4:14.368 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
4:15.587 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.2/5: 64% soul_shard
4:16.893 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
0.3/5: 6% soul_shard
4:18.636 aoe K conflagrate Fluffy_Pillow 49003.5/50000: 98% mana
0.8/5: 16% soul_shard
4:19.941 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
4:21.160 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
1.8/5: 36% soul_shard
4:22.901 aoe H havoc enemy2 49136.0/50000: 98% mana
2.0/5: 40% soul_shard
4:24.208 havoc Q chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
2.2/5: 44% soul_shard
4:26.816 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:28.555 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.2/5: 24% soul_shard
4:29.861 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:31.689 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:33.428 havoc P immolate Fluffy_Pillow 49001.5/50000: 98% mana
1.3/5: 26% soul_shard
4:34.736 havoc N conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.6/5: 32% soul_shard
4:36.142 aoe E channel_demonfire Fluffy_Pillow 49108.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
4:38.954 aoe I rain_of_fire Fluffy_Pillow 49764.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
4:40.262 aoe J decimating_bolt Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
4:42.438 aoe F immolate enemy3 48002.5/50000: 96% mana
0.4/5: 8% soul_shard
backdraft
4:43.745 aoe L incinerate Fluffy_Pillow 47906.0/50000: 96% mana
0.5/5: 10% soul_shard
backdraft
4:44.963 aoe K conflagrate Fluffy_Pillow 47515.0/50000: 95% mana
0.8/5: 16% soul_shard
decimating_bolt(2)
4:46.269 aoe L incinerate Fluffy_Pillow 47668.0/50000: 95% mana
1.5/5: 30% soul_shard
backdraft, decimating_bolt(2)
4:47.489 aoe L incinerate Fluffy_Pillow 47278.0/50000: 95% mana
1.8/5: 36% soul_shard
decimating_bolt
4:49.229 aoe F immolate enemy2 47148.0/50000: 94% mana
2.4/5: 48% soul_shard
4:50.536 aoe L incinerate Fluffy_Pillow 47051.5/50000: 94% mana
2.8/5: 56% soul_shard
4:52.276 aoe I rain_of_fire Fluffy_Pillow 46921.5/50000: 94% mana
3.1/5: 62% soul_shard
4:53.583 default A cataclysm Fluffy_Pillow 47575.0/50000: 95% mana
0.3/5: 6% soul_shard
4:55.325 default 9 soul_fire Fluffy_Pillow 47946.0/50000: 96% mana
0.5/5: 10% soul_shard
4:58.803 aoe E channel_demonfire Fluffy_Pillow 48685.0/50000: 97% mana
1.9/5: 38% soul_shard
5:01.605 aoe H havoc enemy2 49336.0/50000: 99% mana
2.2/5: 44% soul_shard
5:02.912 havoc N conflagrate Fluffy_Pillow 48989.5/50000: 98% mana
2.3/5: 46% soul_shard
5:04.220 havoc Q chaos_bolt Fluffy_Pillow 49143.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
5:06.047 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:07.354 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
5:09.181 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
5:10.921 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
5:12.229 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
5:13.534 aoe L incinerate Fluffy_Pillow 49058.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
5:14.753 aoe F immolate enemy3 48668.0/50000: 97% mana
3.1/5: 62% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Necro_InfernalBrand"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=necrolord
soulbind=214:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_AshenRemains : 9523 dps, 5085 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9523.3 9523.3 16.9 / 0.177% 812.3 / 8.5% 20.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.2 406.7 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_AshenRemains 9523
Cataclysm 773 8.1% 9.6 32.44sec 23966 14108 Direct 28.8 6702 13387 7982 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.60 28.80 0.00 0.00 1.6988 0.0000 230041.46 230041.46 0.00% 14107.78 14107.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 23.25 13 32 6701.58 6142 7261 6701.64 6491 6923 155846 155846 0.00%
crit 19.25% 5.54 0 15 13387.31 12284 14521 13342.53 0 14380 74195 74195 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.68
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1030) 0.0% (10.8%) 12.1 25.04sec 25212 9363

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.14 0.00 181.23 0.00 2.6928 0.1635 0.00 0.00 0.00% 9363.02 9363.02

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.14
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1030 10.8% 0.0 0.00sec 0 0 Direct 543.7 471 944 563 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 543.70 0.00 0.00 0.0000 0.0000 305974.02 305974.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 438.29 324 564 470.93 263 976 471.29 448 499 206419 206419 0.00%
crit 19.39% 105.42 72 152 943.93 525 1952 944.10 798 1074 99555 99555 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1359 (1828) 14.3% (19.2%) 22.4 12.76sec 24197 12310 Direct 44.7 (88.9) 0 9036 9036 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.43 44.67 0.00 0.00 1.9657 0.0000 403669.70 403669.70 0.00% 12309.90 12309.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.67 30 60 9036.12 5870 12241 9035.80 8804 9225 403670 403670 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.52
  • if_expr:cast_time<havoc_remains
    Internal Combustion 469 4.9% 44.3 12.71sec 3143 0 Direct 44.3 2631 5263 3143 19.4%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.27 44.27 0.00 0.00 0.0000 0.0000 139122.91 139122.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 35.66 23 51 2630.95 2 3715 2631.56 2438 2829 93789 93789 0.00%
crit 19.45% 8.61 1 19 5263.46 2 7430 5276.89 3929 7341 45334 45334 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.4% 36.8 7.94sec 6484 5190 Direct 55.4 3615 7250 4308 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.78 55.35 0.00 0.00 1.2494 0.0000 238511.70 238511.70 0.00% 5189.89 5189.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 44.78 29 63 3614.85 2047 5042 3615.78 3360 3845 161884 161884 0.00%
crit 19.10% 10.57 2 22 7249.63 4095 10083 7237.80 5108 8923 76628 76628 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.24
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.53
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1608 16.9% 27.9 10.23sec 17151 13575 Direct 34.7 1538 3071 1842 19.7%
Periodic 343.2 1013 2025 1207 19.2% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.88 34.72 343.21 343.21 1.2635 2.4810 478180.05 478180.05 0.00% 539.26 13575.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 27.90 15 40 1538.36 819 2017 1538.12 1428 1661 42904 42904 0.00%
crit 19.66% 6.83 1 15 3071.49 1641 4033 3072.09 2233 3905 20964 20964 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 277.36 216 354 1012.85 0 1261 1012.90 996 1032 280928 280928 0.00%
crit 19.19% 65.86 41 98 2025.17 3 2521 2025.48 1903 2141 133385 133385 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.83
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.17
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (227) 0.0% (2.4%) 4.7 64.91sec 14478 8751

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.6546 0.0000 0.00 0.00 0.00% 8750.73 8750.73

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.69
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.8 558 1116 663 18.6%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.85 0.00 0.00 0.0000 0.0000 9164.03 9164.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.42% 11.28 6 18 558.02 558 558 558.02 558 558 6293 6293 0.00%
crit 18.58% 2.57 0 8 1116.04 1116 1116 1049.23 0 1116 2871 2871 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 196 2.1% 0.0 0.00sec 0 0 Periodic 101.0 484 967 577 19.4% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.01 101.01 0.0000 1.6127 58304.07 58304.07 0.00% 357.91 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.64% 81.46 56 104 483.64 446 488 483.66 482 486 39396 39396 0.00%
crit 19.36% 19.55 6 33 967.02 891 977 967.09 947 977 18908 18908 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 576 6.1% 41.5 6.63sec 4141 2830 Direct 52.1 (52.1) 2768 5528 3293 19.0% (19.0%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.47 52.15 0.00 0.00 1.4635 0.0000 171746.82 171746.82 0.00% 2829.62 2829.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.96% 42.22 25 63 2767.95 1333 3426 2770.68 2568 3009 116867 116867 0.00%
crit 19.04% 9.93 1 20 5527.64 2719 6852 5536.30 4242 6526 54880 54880 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.65
    havoc
    [R]:11.06
  • if_expr:cast_time<havoc_remains
Rain of Fire 858 9.0% 16.3 17.96sec 15666 12548 Periodic 386.4 553 1106 660 19.4% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.28 0.00 0.00 386.35 1.2486 0.0000 255125.57 255125.57 0.00% 12547.98 12547.98
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.57% 311.29 207 447 552.87 507 599 552.90 543 561 172112 172112 0.00%
crit 19.43% 75.06 42 117 1105.89 1013 1198 1105.95 1086 1129 83014 83014 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.18
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.13
Soul Fire 506 5.3% 5.5 49.55sec 27251 7837 Direct 7.5 16676 33721 19983 19.4%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.53 0.00 0.00 3.4775 0.0000 150407.87 150407.87 0.00% 7836.60 7836.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 6.07 2 9 16675.82 8605 21176 16702.48 14277 20255 101252 101252 0.00%
crit 19.38% 1.46 0 5 33721.26 17314 42344 27318.39 0 42182 49156 49156 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.54
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.08
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.52sec 12003 10383 Direct 6.0 3348 6696 4000 19.5%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24005.80 24005.80 0.00% 10383.13 10383.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 4.83 1 6 3348.13 3348 3348 3348.13 3348 3348 16172 16172 0.00%
crit 19.50% 1.17 0 5 6696.27 6696 6696 4854.25 0 6696 7834 7834 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3514 / 718
Immolation 3248 6.9% 39.0 5.49sec 4997 0 Direct 117.0 1395 2790 1665 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194899.29 194899.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 94.29 79 110 1395.06 1395 1395 1395.06 1395 1395 131544 131544 0.00%
crit 19.41% 22.71 7 38 2790.11 2790 2790 2790.11 2790 2790 63355 63355 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 265 0.6% 41.0 5.25sec 389 270 Direct 41.0 326 651 388 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15930.46 22755.07 29.99% 270.45 270.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 33.07 22 40 325.55 326 326 325.55 326 326 10765 15376 29.99%
crit 19.35% 7.93 1 19 651.10 651 651 651.10 651 651 5166 7379 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1651 1135 Direct 91.9 1395 2790 1665 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152925.70 152925.70 0.00% 1134.54 1134.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 74.13 52 100 1395.06 1395 1395 1395.06 1395 1395 103412 103412 0.00%
crit 19.32% 17.75 8 33 2790.11 2790 2790 2790.11 2790 2790 49513 49513 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Venthyr_AshenRemains
Havoc 9.6 32.22sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.56 0.00 0.00 0.00 1.2437 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.56
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.4sec 54.14% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:Venthyr_AshenRemains
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.6s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.14%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_AshenRemains
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_AshenRemains_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.8s
  • trigger_min/max:180.0s / 184.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_AshenRemains_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.8s
  • trigger_min/max:180.0s / 184.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.54% 8.38% 14.06% 0.8s 0.0s 6.3s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_AshenRemains
soul_fire Soul Shard 6.53 7.21 7.75% 1.10 0.37 4.87%
immolate Soul Shard 343.26 33.12 35.61% 0.10 1.20 3.51%
incinerate Soul Shard 41.51 10.50 11.29% 0.25 0.00 0.04%
conflagrate Soul Shard 36.77 27.67 29.75% 0.75 0.00 0.00%
mana_regen Mana 651.59 121078.31 100.00% 185.82 27442.95 18.48%
immolate_crits Soul Shard 33.08 3.20 3.44% 0.10 0.11 3.31%
incinerate_crits Soul Shard 9.93 0.99 1.07% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.32 11.10% 0.09 1.68 14.00%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.70 410.24 27472.8 48947.6 46851.5 50000.0
Soul Shard 4.0 0.31 0.31 3.4 2.3 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_AshenRemains
cataclysm Mana 9.6 4804.4 500.0 500.5 47.9
channel_demonfire Mana 12.1 9107.6 750.0 750.5 33.6
chaos_bolt Soul Shard 22.4 44.8 2.0 2.0 12117.3
conflagrate Mana 36.8 18386.4 500.0 499.9 13.0
havoc Mana 9.6 9563.1 1000.0 1000.7 0.0
immolate Mana 27.9 20907.7 750.0 749.9 22.9
impending_catastrophe Mana 4.7 9337.5 2000.0 2003.7 7.2
incinerate Mana 41.5 41506.3 1000.0 1000.8 4.1
rain_of_fire Soul Shard 16.3 48.9 3.0 3.0 5216.4
soul_fire Mana 6.5 6526.8 1000.0 1182.5 23.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_AshenRemains Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Venthyr_AshenRemains Damage Per Second
Count 618
Mean 9523.34
Minimum 9006.07
Maximum 10242.17
Spread ( max - min ) 1236.10
Range [ ( max - min ) / 2 * 100% ] 6.49%
Standard Deviation 214.2584
5th Percentile 9192.69
95th Percentile 9893.29
( 95th Percentile - 5th Percentile ) 700.61
Mean Distribution
Standard Deviation 8.6187
95.00% Confidence Interval ( 9506.44 - 9540.23 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1945
0.1 Scale Factor Error with Delta=300 392
0.05 Scale Factor Error with Delta=300 1568
0.01 Scale Factor Error with Delta=300 39189
Priority Target DPS
Venthyr_AshenRemains Priority Target Damage Per Second
Count 618
Mean 5085.41
Minimum 4758.55
Maximum 5428.44
Spread ( max - min ) 669.89
Range [ ( max - min ) / 2 * 100% ] 6.59%
Standard Deviation 127.8147
5th Percentile 4883.46
95th Percentile 5314.20
( 95th Percentile - 5th Percentile ) 430.75
Mean Distribution
Standard Deviation 5.1415
95.00% Confidence Interval ( 5075.34 - 5095.49 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2427
0.1 Scale Factor Error with Delta=300 140
0.05 Scale Factor Error with Delta=300 558
0.01 Scale Factor Error with Delta=300 13946
DPS(e)
Venthyr_AshenRemains Damage Per Second (Effective)
Count 618
Mean 9523.34
Minimum 9006.07
Maximum 10242.17
Spread ( max - min ) 1236.10
Range [ ( max - min ) / 2 * 100% ] 6.49%
Damage
Venthyr_AshenRemains Damage
Count 618
Mean 2464253.99
Minimum 1986453.96
Maximum 2959989.98
Spread ( max - min ) 973536.02
Range [ ( max - min ) / 2 * 100% ] 19.75%
DTPS
Venthyr_AshenRemains Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_AshenRemains Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_AshenRemains Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_AshenRemains Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_AshenRemains Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_AshenRemains Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_AshenRemainsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_AshenRemains Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.54 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.68 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.18 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.14 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.83 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.56 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.13 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.24 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.69 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.65 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.53 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.08 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.17 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.52 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.06 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLDJLALJEHQQRNOFFIFJIELJLALLHNQQPNQELFFFJKLI9AHNQNQRRNEFFIFLJLLILJAHRQRNPQ9EJFIKFLJLLAHNQQRNPEILJLFMLDJLL9AEHQNQNPQDLJFKEFFLJIAHRNQRRQP9EFFJILJLJAHQRNQRPEJLIKFLJLLLI9AEHNQNQPRNILL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.742 aoe E channel_demonfire Fluffy_Pillow 49371.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.920 cds M summon_infernal Fluffy_Pillow 49710.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.926 aoe H havoc enemy2 49213.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.934 havoc Q chaos_bolt Fluffy_Pillow 48717.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.943 havoc N conflagrate Fluffy_Pillow 49721.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.951 havoc Q chaos_bolt Fluffy_Pillow 49725.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.357 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:11.362 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:12.368 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.774 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.780 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.186 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:17.192 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.196 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.708 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.716 aoe F immolate enemy2 49253.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.723 aoe F immolate enemy3 49006.5/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.729 aoe D rain_of_fire Fluffy_Pillow 48759.5/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:24.737 aoe K impending_catastrophe Fluffy_Pillow 49263.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.077 aoe L incinerate Fluffy_Pillow 47933.5/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:27.016 aoe J conflagrate Fluffy_Pillow 47403.0/50000: 95% mana
1.7/5: 34% soul_shard
bloodlust
0:28.023 aoe L incinerate Fluffy_Pillow 47406.5/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:28.962 aoe D rain_of_fire Fluffy_Pillow 46876.0/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust
0:29.968 aoe J conflagrate Fluffy_Pillow 47379.0/50000: 95% mana
0.5/5: 10% soul_shard
bloodlust
0:30.975 aoe L incinerate Fluffy_Pillow 47382.5/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:31.915 default A cataclysm Fluffy_Pillow 46852.5/50000: 94% mana
1.9/5: 38% soul_shard
bloodlust
0:33.256 aoe L incinerate Fluffy_Pillow 47023.0/50000: 94% mana
2.3/5: 46% soul_shard
bloodlust
0:34.596 aoe J conflagrate Fluffy_Pillow 46693.0/50000: 93% mana
2.9/5: 58% soul_shard
bloodlust
0:35.604 aoe E channel_demonfire Fluffy_Pillow 46697.0/50000: 93% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:37.841 aoe H havoc enemy2 47065.5/50000: 94% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:38.849 havoc Q chaos_bolt Fluffy_Pillow 46569.5/50000: 93% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:40.255 havoc Q chaos_bolt Fluffy_Pillow 47272.5/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust
0:42.263 havoc R incinerate Fluffy_Pillow 48276.5/50000: 97% mana
0.7/5: 14% soul_shard
0:44.002 havoc N conflagrate Fluffy_Pillow 48146.0/50000: 96% mana
1.2/5: 24% soul_shard
0:45.309 havoc O soul_fire Fluffy_Pillow 48299.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
0:48.786 aoe F immolate enemy2 49002.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:50.092 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:51.399 aoe I rain_of_fire Fluffy_Pillow 48808.5/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
0:52.707 aoe F immolate enemy3 49462.5/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
0:54.014 aoe J conflagrate Fluffy_Pillow 49252.5/50000: 99% mana
2.4/5: 48% soul_shard
0:55.322 aoe I rain_of_fire Fluffy_Pillow 49406.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
0:56.629 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
0:59.427 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:00.647 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:01.955 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
1:03.173 default A cataclysm Fluffy_Pillow 48765.5/50000: 98% mana
2.1/5: 42% soul_shard
1:04.992 aoe L incinerate Fluffy_Pillow 49175.0/50000: 98% mana
2.2/5: 44% soul_shard
1:06.733 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
1:08.474 aoe H havoc enemy2 48873.0/50000: 98% mana
3.1/5: 62% soul_shard
1:09.782 havoc N conflagrate Fluffy_Pillow 48527.0/50000: 97% mana
3.2/5: 64% soul_shard
1:11.088 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
4.5/5: 90% soul_shard
backdraft
1:12.915 havoc Q chaos_bolt Fluffy_Pillow 49593.5/50000: 99% mana
2.6/5: 52% soul_shard
1:15.524 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:16.828 havoc N conflagrate Fluffy_Pillow 49251.0/50000: 99% mana
1.3/5: 26% soul_shard
1:18.134 havoc Q chaos_bolt Fluffy_Pillow 49404.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
1:19.962 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
1:22.840 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:24.580 aoe F immolate enemy3 49002.0/50000: 98% mana
1.5/5: 30% soul_shard
1:25.887 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
1.5/5: 30% soul_shard
1:27.195 aoe F immolate enemy2 48809.5/50000: 98% mana
1.9/5: 38% soul_shard
1:28.501 aoe J conflagrate Fluffy_Pillow 48712.5/50000: 97% mana
1.9/5: 38% soul_shard
1:29.807 aoe K impending_catastrophe Fluffy_Pillow 48865.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
1:31.548 aoe L incinerate Fluffy_Pillow 47736.0/50000: 95% mana
2.8/5: 56% soul_shard
backdraft
1:32.767 aoe I rain_of_fire Fluffy_Pillow 47345.5/50000: 95% mana
3.2/5: 64% soul_shard
1:34.073 default 9 soul_fire Fluffy_Pillow 47998.5/50000: 96% mana
0.3/5: 6% soul_shard
1:37.550 default A cataclysm Fluffy_Pillow 48737.0/50000: 97% mana
1.9/5: 38% soul_shard
1:39.291 aoe H havoc enemy2 49107.5/50000: 98% mana
2.0/5: 40% soul_shard
1:40.598 havoc N conflagrate Fluffy_Pillow 48761.0/50000: 98% mana
2.2/5: 44% soul_shard
1:41.905 havoc Q chaos_bolt Fluffy_Pillow 48914.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:43.734 havoc N conflagrate Fluffy_Pillow 49829.0/50000: 100% mana
1.6/5: 32% soul_shard
1:45.041 havoc Q chaos_bolt Fluffy_Pillow 49982.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
1:46.868 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
1:48.609 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
1:50.351 havoc N conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
2.2/5: 44% soul_shard
1:51.769 aoe E channel_demonfire Fluffy_Pillow 49082.5/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:54.639 aoe F immolate enemy2 49767.5/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:55.946 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
3.9/5: 78% soul_shard
backdraft
1:57.252 aoe I rain_of_fire Fluffy_Pillow 49155.5/50000: 98% mana
3.9/5: 78% soul_shard
backdraft
1:58.558 aoe F immolate enemy3 49808.5/50000: 100% mana
1.2/5: 24% soul_shard
backdraft
1:59.865 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:01.083 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
1.6/5: 32% soul_shard
2:02.389 aoe L incinerate Fluffy_Pillow 49014.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:03.607 aoe L incinerate Fluffy_Pillow 48623.5/50000: 97% mana
2.6/5: 52% soul_shard
2:05.346 aoe I rain_of_fire Fluffy_Pillow 48493.0/50000: 97% mana
3.1/5: 62% soul_shard
2:06.653 aoe L incinerate Fluffy_Pillow 49146.5/50000: 98% mana
0.2/5: 4% soul_shard
2:08.395 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.6/5: 12% soul_shard
2:09.701 default A cataclysm Fluffy_Pillow 49156.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:11.443 aoe H havoc enemy2 49503.0/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
2:12.750 havoc R incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:13.969 havoc Q chaos_bolt Fluffy_Pillow 48766.0/50000: 98% mana
2.1/5: 42% soul_shard
2:16.580 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:18.321 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:19.627 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
2:20.933 havoc Q chaos_bolt Fluffy_Pillow 49058.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:22.760 default 9 soul_fire Fluffy_Pillow 49972.0/50000: 100% mana
0.7/5: 14% soul_shard
2:26.238 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
2:29.027 aoe J conflagrate Fluffy_Pillow 49647.0/50000: 99% mana
2.6/5: 52% soul_shard
2:30.332 aoe F immolate enemy3 49799.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
2:31.637 aoe I rain_of_fire Fluffy_Pillow 49251.5/50000: 99% mana
3.4/5: 68% soul_shard
backdraft
2:32.945 aoe K impending_catastrophe Fluffy_Pillow 49905.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
2:34.685 aoe F immolate enemy2 48002.0/50000: 96% mana
0.7/5: 14% soul_shard
backdraft
2:35.991 aoe L incinerate Fluffy_Pillow 47905.0/50000: 96% mana
0.8/5: 16% soul_shard
backdraft
2:37.210 aoe J conflagrate Fluffy_Pillow 47514.5/50000: 95% mana
1.2/5: 24% soul_shard
2:38.517 aoe L incinerate Fluffy_Pillow 47668.0/50000: 95% mana
1.8/5: 36% soul_shard
backdraft
2:39.737 aoe L incinerate Fluffy_Pillow 47278.0/50000: 95% mana
2.2/5: 44% soul_shard
2:41.477 default A cataclysm Fluffy_Pillow 47148.0/50000: 94% mana
2.5/5: 50% soul_shard
2:43.218 aoe H havoc enemy2 47518.5/50000: 95% mana
2.9/5: 58% soul_shard
2:44.523 havoc N conflagrate Fluffy_Pillow 47171.0/50000: 94% mana
3.2/5: 64% soul_shard
2:45.831 havoc Q chaos_bolt Fluffy_Pillow 47325.0/50000: 95% mana
4.3/5: 86% soul_shard
backdraft
2:47.660 havoc Q chaos_bolt Fluffy_Pillow 48239.5/50000: 96% mana
2.6/5: 52% soul_shard
2:50.270 havoc R incinerate Fluffy_Pillow 49544.5/50000: 99% mana
0.9/5: 18% soul_shard
2:52.010 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
2:53.317 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
2:54.623 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
2:57.326 aoe I rain_of_fire Fluffy_Pillow 49660.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
2:58.632 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
2:59.852 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
3:01.160 aoe L incinerate Fluffy_Pillow 49156.5/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:02.379 aoe F immolate enemy3 48766.0/50000: 98% mana
1.7/5: 34% soul_shard
3:03.686 cds M summon_infernal Fluffy_Pillow 48669.5/50000: 97% mana
1.9/5: 38% soul_shard
3:05.227 aoe L incinerate Fluffy_Pillow 48440.0/50000: 97% mana
2.4/5: 48% soul_shard
3:06.967 aoe D rain_of_fire Fluffy_Pillow 48310.0/50000: 97% mana
3.1/5: 62% soul_shard
3:08.274 aoe J conflagrate Fluffy_Pillow 48963.5/50000: 98% mana
0.5/5: 10% soul_shard
3:09.609 aoe L incinerate Fluffy_Pillow 49131.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
3:10.829 aoe L incinerate Fluffy_Pillow 48741.0/50000: 97% mana
2.0/5: 40% soul_shard
3:12.572 default 9 soul_fire Fluffy_Pillow 48612.5/50000: 97% mana
2.7/5: 54% soul_shard
3:16.048 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
5.0/5: 100% soul_shard
3:17.789 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
5.0/5: 100% soul_shard
3:20.621 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
3:21.928 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
3:24.538 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.845 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.4/5: 88% soul_shard
backdraft
3:27.671 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
3:28.977 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.6/5: 92% soul_shard
backdraft
3:30.284 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:32.112 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:33.420 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
3:35.160 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
3:36.467 aoe F immolate enemy3 49155.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:37.774 aoe K impending_catastrophe Fluffy_Pillow 49059.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:39.515 aoe E channel_demonfire Fluffy_Pillow 47929.5/50000: 96% mana
2.0/5: 40% soul_shard
backdraft
3:42.338 aoe F immolate Fluffy_Pillow 48591.0/50000: 97% mana
2.3/5: 46% soul_shard
backdraft
3:43.645 aoe F immolate enemy2 48494.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
3:44.952 aoe L incinerate Fluffy_Pillow 48398.0/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
3:46.171 aoe J conflagrate Fluffy_Pillow 48007.5/50000: 96% mana
2.8/5: 56% soul_shard
3:47.477 aoe I rain_of_fire Fluffy_Pillow 48160.5/50000: 96% mana
3.5/5: 70% soul_shard
backdraft
3:48.781 default A cataclysm Fluffy_Pillow 48812.5/50000: 98% mana
0.6/5: 12% soul_shard
backdraft
3:50.523 aoe H havoc enemy2 49183.5/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
3:51.927 havoc R incinerate Fluffy_Pillow 48885.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:53.148 havoc N conflagrate Fluffy_Pillow 48496.0/50000: 97% mana
1.6/5: 32% soul_shard
3:54.455 havoc Q chaos_bolt Fluffy_Pillow 48649.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
3:56.281 havoc R incinerate Fluffy_Pillow 49562.5/50000: 99% mana
1.0/5: 20% soul_shard
3:58.021 havoc R incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.7/5: 34% soul_shard
3:59.761 havoc Q chaos_bolt Fluffy_Pillow 48872.0/50000: 98% mana
2.3/5: 46% soul_shard
4:02.371 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
4:03.677 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
4:07.154 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
4:10.095 aoe F immolate enemy2 49722.5/50000: 99% mana
2.3/5: 46% soul_shard
4:11.400 aoe F immolate enemy3 49251.5/50000: 99% mana
2.4/5: 48% soul_shard
4:12.707 aoe J conflagrate Fluffy_Pillow 49155.0/50000: 98% mana
2.5/5: 50% soul_shard
4:14.013 aoe I rain_of_fire Fluffy_Pillow 49308.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
4:15.320 aoe L incinerate Fluffy_Pillow 49961.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
4:16.538 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
4:17.845 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
4:19.066 aoe J conflagrate Fluffy_Pillow 48765.5/50000: 98% mana
1.6/5: 32% soul_shard
4:20.371 default A cataclysm Fluffy_Pillow 48918.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:22.257 aoe H havoc enemy2 49361.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:23.564 havoc Q chaos_bolt Fluffy_Pillow 49014.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:25.391 havoc R incinerate Fluffy_Pillow 49928.0/50000: 100% mana
0.9/5: 18% soul_shard
4:27.131 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.6/5: 32% soul_shard
4:28.436 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:30.262 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
4:32.003 havoc P immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.7/5: 34% soul_shard
4:33.309 aoe E channel_demonfire Fluffy_Pillow 48905.5/50000: 98% mana
1.9/5: 38% soul_shard
4:36.260 aoe J conflagrate Fluffy_Pillow 49631.0/50000: 99% mana
2.3/5: 46% soul_shard
4:37.566 aoe L incinerate Fluffy_Pillow 49784.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
4:38.785 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.3/5: 66% soul_shard
4:40.090 aoe K impending_catastrophe Fluffy_Pillow 49654.5/50000: 99% mana
0.5/5: 10% soul_shard
4:41.831 aoe F immolate enemy3 48002.5/50000: 96% mana
0.8/5: 16% soul_shard
4:43.138 aoe L incinerate Fluffy_Pillow 47906.0/50000: 96% mana
0.9/5: 18% soul_shard
4:44.879 aoe J conflagrate Fluffy_Pillow 47776.5/50000: 96% mana
1.3/5: 26% soul_shard
4:46.187 aoe L incinerate Fluffy_Pillow 47930.5/50000: 96% mana
1.9/5: 38% soul_shard
backdraft
4:47.406 aoe L incinerate Fluffy_Pillow 47540.0/50000: 95% mana
2.4/5: 48% soul_shard
4:49.149 aoe L incinerate Fluffy_Pillow 47411.5/50000: 95% mana
2.9/5: 58% soul_shard
4:50.889 aoe I rain_of_fire Fluffy_Pillow 47281.5/50000: 95% mana
3.4/5: 68% soul_shard
4:52.195 default 9 soul_fire Fluffy_Pillow 47934.5/50000: 96% mana
0.6/5: 12% soul_shard
4:55.672 default A cataclysm Fluffy_Pillow 48673.0/50000: 97% mana
2.0/5: 40% soul_shard
4:57.412 aoe E channel_demonfire Fluffy_Pillow 49043.0/50000: 98% mana
2.1/5: 42% soul_shard
5:00.201 aoe H havoc enemy2 49687.5/50000: 99% mana
2.5/5: 50% soul_shard
5:01.508 havoc N conflagrate Fluffy_Pillow 49341.0/50000: 99% mana
2.5/5: 50% soul_shard
5:02.815 havoc Q chaos_bolt Fluffy_Pillow 49494.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
5:04.643 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
5:05.950 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
5:07.778 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
5:09.085 havoc R incinerate Fluffy_Pillow 49252.5/50000: 99% mana
1.5/5: 30% soul_shard
5:10.824 havoc N conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.2/5: 44% soul_shard
5:12.129 aoe I rain_of_fire Fluffy_Pillow 49154.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
5:13.436 aoe L incinerate Fluffy_Pillow 49807.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
5:14.655 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_AshenRemains"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=211:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_CataOrigin : 9541 dps, 5049 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9541.4 9541.4 17.5 / 0.183% 807.8 / 8.5% 20.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.2 406.5 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_CataOrigin 9541
Cataclysm 777 8.2% 9.6 32.43sec 24036 14149 Direct 28.8 6702 13388 8011 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.61 28.83 0.00 0.00 1.6989 0.0000 230946.35 230946.35 0.00% 14148.52 14148.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 23.17 13 32 6701.52 6141 7261 6700.50 6504 6919 155273 155273 0.00%
crit 19.61% 5.65 1 12 13387.59 12284 14520 13382.17 12511 14373 75674 75674 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.67
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1030) 0.0% (10.8%) 12.2 25.25sec 25115 9332

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.19 0.00 181.69 0.00 2.6912 0.1635 0.00 0.00 0.00% 9332.40 9332.40

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.19
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1030 10.8% 0.0 0.00sec 0 0 Direct 545.1 471 942 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 545.07 0.00 0.00 0.0000 0.0000 306055.96 306055.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 439.96 324 568 470.80 263 976 471.03 444 498 207124 207124 0.00%
crit 19.28% 105.11 68 145 941.69 525 1952 941.60 801 1111 98932 98932 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1286 (1757) 13.5% (18.4%) 22.5 12.65sec 23184 11780 Direct 44.8 (89.2) 0 8520 8520 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.49 44.80 0.00 0.00 1.9682 0.0000 381730.19 381730.19 0.00% 11779.61 11779.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.80 32 60 8520.24 5861 11548 8519.69 8279 8670 381730 381730 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.59
  • if_expr:cast_time<havoc_remains
    Internal Combustion 471 4.9% 44.4 12.65sec 3143 0 Direct 44.4 2632 5251 3143 19.5%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.44 44.43 0.00 0.00 0.0000 0.0000 139646.98 139646.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 35.75 24 53 2631.52 1 3715 2631.47 2411 2807 94041 94041 0.00%
crit 19.53% 8.68 2 19 5251.22 9 7430 5262.24 3758 6546 45606 45606 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.4% 36.8 7.93sec 6482 5188 Direct 55.3 3621 7194 4307 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.78 55.35 0.00 0.00 1.2494 0.0000 238368.25 238368.25 0.00% 5187.78 5187.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 44.71 29 58 3620.71 2047 5042 3620.97 3422 3855 161876 161876 0.00%
crit 19.22% 10.64 2 23 7193.78 4095 10083 7195.35 5395 8885 76493 76493 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.24
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.53
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1610 16.9% 28.0 10.30sec 17077 13513 Direct 34.9 1537 3068 1834 19.4%
Periodic 343.2 1013 2025 1208 19.3% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.04 34.95 343.22 343.22 1.2637 2.4816 478837.30 478837.30 0.00% 539.72 13513.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 28.18 17 41 1537.24 819 2017 1537.92 1414 1647 43327 43327 0.00%
crit 19.37% 6.77 1 16 3068.14 1641 4033 3062.23 2159 3911 20767 20767 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.69% 276.94 213 352 1012.88 0 1261 1012.91 996 1036 280500 280500 0.00%
crit 19.31% 66.28 42 105 2025.15 2 2521 2025.18 1909 2131 134244 134244 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.94
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.17
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (354) 0.0% (3.7%) 4.7 64.77sec 22572 13642

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.6547 0.0000 0.00 0.00 0.00% 13642.10 13642.10

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.69
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.8 558 1116 669 19.9%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.83 0.00 0.00 0.0000 0.0000 9253.42 9253.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.06% 11.07 5 18 558.02 558 558 558.02 558 558 6176 6176 0.00%
crit 19.94% 2.76 0 8 1116.04 1116 1116 1060.06 0 1116 3077 3077 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 323 3.4% 0.0 0.00sec 0 0 Periodic 170.0 473 946 564 19.2% 30.7%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 170.02 170.02 0.0000 1.6108 95899.87 95899.87 0.00% 350.16 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 137.33 101 168 473.14 27 488 473.06 467 483 64974 64974 0.00%
crit 19.23% 32.69 15 52 946.10 54 977 945.53 847 977 30926 30926 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 542 5.7% 41.3 6.59sec 3912 2675 Direct 51.8 (51.8) 2614 5224 3117 19.3% (19.3%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.29 51.80 0.00 0.00 1.4627 0.0000 161517.65 161517.65 0.00% 2674.53 2674.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 41.79 24 64 2614.31 1312 3232 2616.12 2438 2791 109230 109230 0.00%
crit 19.32% 10.01 1 24 5224.04 2627 6464 5233.58 4127 6424 52288 52288 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.63
    havoc
    [R]:10.89
  • if_expr:cast_time<havoc_remains
Rain of Fire 852 8.9% 16.2 17.98sec 15633 12527 Periodic 384.4 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.21 0.00 0.00 384.41 1.2480 0.0000 253371.55 253371.55 0.00% 12527.02 12527.02
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 310.63 208 467 552.90 507 599 552.91 545 560 171756 171756 0.00%
crit 19.19% 73.78 39 110 1106.11 1013 1198 1106.16 1083 1129 81615 81615 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.15
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.06
Soul Fire 502 5.3% 5.5 49.28sec 26997 7763 Direct 7.5 16726 33711 19834 18.3%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.53 7.53 0.00 0.00 3.4775 0.0000 149267.94 149267.94 0.00% 7763.45 7763.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.71% 6.15 1 10 16725.78 8602 21176 16763.70 13085 20051 102929 102929 0.00%
crit 18.29% 1.38 0 6 33710.61 17284 42351 26117.03 0 42350 46339 46339 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.57
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.06
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.50sec 12044 10418 Direct 6.0 3348 6696 4014 19.9%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24087.07 24087.07 0.00% 10418.28 10418.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.10% 4.81 2 6 3348.13 3348 3348 3348.13 3348 3348 16091 16091 0.00%
crit 19.90% 1.19 0 4 6696.27 6696 6696 4908.43 0 6696 7997 7997 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3520 / 719
Immolation 3254 6.9% 39.0 5.49sec 5006 0 Direct 117.0 1395 2790 1669 19.6%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 195242.41 195242.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 94.05 79 106 1395.06 1395 1395 1395.06 1395 1395 131201 131201 0.00%
crit 19.62% 22.95 11 38 2790.11 2790 2790 2790.11 2790 2790 64042 64042 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15951.00 22784.41 29.99% 270.80 270.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 33.00 25 39 325.55 326 326 325.55 326 326 10744 15347 29.99%
crit 19.50% 8.00 2 16 651.10 651 651 651.10 651 651 5207 7437 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1650 1134 Direct 91.9 1395 2790 1664 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152824.12 152824.12 0.00% 1133.79 1133.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 74.20 54 99 1395.06 1395 1395 1395.06 1395 1395 103514 103514 0.00%
crit 19.24% 17.67 8 31 2790.11 2790 2790 2790.11 2790 2790 49310 49310 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Venthyr_CataOrigin
Havoc 9.6 32.18sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.56 0.00 0.00 0.00 1.2437 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.56
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.4sec 54.12% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:Venthyr_CataOrigin
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.4s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.12%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_CataOrigin
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_CataOrigin_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.8s
  • trigger_min/max:180.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_CataOrigin_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.8s
  • trigger_min/max:180.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.57% 7.60% 14.33% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_CataOrigin
soul_fire Soul Shard 6.54 7.22 7.78% 1.10 0.36 4.74%
immolate Soul Shard 343.31 33.08 35.63% 0.10 1.25 3.63%
incinerate Soul Shard 41.32 10.43 11.23% 0.25 0.00 0.04%
conflagrate Soul Shard 36.77 27.66 29.79% 0.75 0.00 0.00%
mana_regen Mana 651.18 121001.11 100.00% 185.82 27530.58 18.54%
immolate_crits Soul Shard 33.07 3.19 3.43% 0.10 0.12 3.58%
incinerate_crits Soul Shard 10.00 1.00 1.08% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.27 11.06% 0.09 1.73 14.44%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.46 410.17 27552.0 48895.2 46420.0 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.2 0.1 5.0
Usage Type Count Total Avg RPE APR
Venthyr_CataOrigin
cataclysm Mana 9.6 4809.1 500.0 500.5 48.0
channel_demonfire Mana 12.2 9143.1 750.0 750.3 33.5
chaos_bolt Soul Shard 22.5 44.9 2.0 2.0 11600.0
conflagrate Mana 36.8 18384.9 500.0 499.9 13.0
havoc Mana 9.6 9563.1 1000.0 1000.7 0.0
immolate Mana 28.0 21015.4 750.0 749.5 22.8
impending_catastrophe Mana 4.7 9334.4 2000.0 2003.7 11.3
incinerate Mana 41.3 41323.3 1000.0 1000.9 3.9
rain_of_fire Soul Shard 16.2 48.6 3.0 3.0 5210.3
soul_fire Mana 6.5 6536.3 1000.0 1182.2 22.8
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_CataOrigin Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Venthyr_CataOrigin Damage Per Second
Count 618
Mean 9541.43
Minimum 9084.53
Maximum 10198.61
Spread ( max - min ) 1114.08
Range [ ( max - min ) / 2 * 100% ] 5.84%
Standard Deviation 221.5013
5th Percentile 9204.18
95th Percentile 9915.35
( 95th Percentile - 5th Percentile ) 711.17
Mean Distribution
Standard Deviation 8.9101
95.00% Confidence Interval ( 9523.96 - 9558.89 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2071
0.1 Scale Factor Error with Delta=300 419
0.05 Scale Factor Error with Delta=300 1676
0.01 Scale Factor Error with Delta=300 41883
Priority Target DPS
Venthyr_CataOrigin Priority Target Damage Per Second
Count 618
Mean 5048.79
Minimum 4787.55
Maximum 5621.21
Spread ( max - min ) 833.66
Range [ ( max - min ) / 2 * 100% ] 8.26%
Standard Deviation 129.0914
5th Percentile 4849.65
95th Percentile 5281.36
( 95th Percentile - 5th Percentile ) 431.71
Mean Distribution
Standard Deviation 5.1928
95.00% Confidence Interval ( 5038.62 - 5058.97 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2512
0.1 Scale Factor Error with Delta=300 143
0.05 Scale Factor Error with Delta=300 570
0.01 Scale Factor Error with Delta=300 14226
DPS(e)
Venthyr_CataOrigin Damage Per Second (Effective)
Count 618
Mean 9541.43
Minimum 9084.53
Maximum 10198.61
Spread ( max - min ) 1114.08
Range [ ( max - min ) / 2 * 100% ] 5.84%
Damage
Venthyr_CataOrigin Damage
Count 618
Mean 2468982.53
Minimum 2019876.62
Maximum 3004821.63
Spread ( max - min ) 984945.01
Range [ ( max - min ) / 2 * 100% ] 19.95%
DTPS
Venthyr_CataOrigin Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_CataOrigin Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_CataOrigin Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_CataOrigin Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_CataOrigin Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_CataOrigin Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_CataOriginTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_CataOrigin Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.57 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.67 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.15 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.19 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.94 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.56 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.06 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.24 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.69 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.63 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.53 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.06 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.17 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.59 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.89 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLDJLALJEHQQRNOFFIFJLEIJLALLHNQQPNQELFFFJKLL9AHQNQNQPNEILLFJFFLLIJAHRQRNQP9EJFIKLJFLLAHNQQRNPEILJLFMLLDJ9AEHQNQNPQDLJFKEFFIJALHNQRRQP9EFJILJLLJAHQRQRNPELIJFKLJLFLI9AEHNQNQPRNILLF

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.923 cds M summon_infernal Fluffy_Pillow 49711.5/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.929 aoe H havoc enemy2 49214.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.935 havoc Q chaos_bolt Fluffy_Pillow 48717.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.943 havoc N conflagrate Fluffy_Pillow 49721.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.949 havoc Q chaos_bolt Fluffy_Pillow 49724.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.355 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.361 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.368 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust, backdraft
0:13.773 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.779 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:16.187 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:17.193 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.199 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
bloodlust, backdraft
0:20.751 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:21.757 aoe F immolate enemy2 49252.0/50000: 99% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:22.765 aoe F immolate enemy3 49006.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.771 aoe D rain_of_fire Fluffy_Pillow 48759.0/50000: 98% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:24.778 aoe K impending_catastrophe Fluffy_Pillow 49262.5/50000: 99% mana
0.6/5: 12% soul_shard
bloodlust, backdraft
0:26.118 aoe L incinerate Fluffy_Pillow 47932.5/50000: 96% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:27.058 aoe J conflagrate Fluffy_Pillow 47402.5/50000: 95% mana
1.7/5: 34% soul_shard
bloodlust
0:28.065 aoe L incinerate Fluffy_Pillow 47406.0/50000: 95% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:29.004 aoe D rain_of_fire Fluffy_Pillow 46875.5/50000: 94% mana
3.1/5: 62% soul_shard
bloodlust
0:30.010 aoe J conflagrate Fluffy_Pillow 47378.5/50000: 95% mana
0.5/5: 10% soul_shard
bloodlust
0:31.018 aoe L incinerate Fluffy_Pillow 47382.5/50000: 95% mana
1.3/5: 26% soul_shard
bloodlust, backdraft
0:31.956 default A cataclysm Fluffy_Pillow 46851.5/50000: 94% mana
1.9/5: 38% soul_shard
bloodlust
0:33.297 aoe L incinerate Fluffy_Pillow 47022.0/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:34.637 aoe J conflagrate Fluffy_Pillow 46692.0/50000: 93% mana
2.8/5: 56% soul_shard
bloodlust
0:35.644 aoe E channel_demonfire Fluffy_Pillow 46695.5/50000: 93% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:37.920 aoe H havoc enemy2 47083.5/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:38.925 havoc Q chaos_bolt Fluffy_Pillow 46586.0/50000: 93% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:40.331 havoc Q chaos_bolt Fluffy_Pillow 47289.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust
0:42.340 havoc R incinerate Fluffy_Pillow 48293.5/50000: 97% mana
0.6/5: 12% soul_shard
0:44.081 havoc N conflagrate Fluffy_Pillow 48164.0/50000: 96% mana
1.2/5: 24% soul_shard
0:45.387 havoc O soul_fire Fluffy_Pillow 48317.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
0:48.863 aoe F immolate enemy2 49001.5/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:50.168 aoe F immolate Fluffy_Pillow 48904.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:51.474 aoe I rain_of_fire Fluffy_Pillow 48807.0/50000: 98% mana
4.9/5: 98% soul_shard
backdraft
0:52.782 aoe F immolate enemy3 49461.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
0:54.088 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.2/5: 44% soul_shard
0:55.394 aoe L incinerate Fluffy_Pillow 49405.0/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
0:56.614 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
0:59.509 aoe I rain_of_fire Fluffy_Pillow 49700.0/50000: 99% mana
3.5/5: 70% soul_shard
1:00.818 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:02.126 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
1:03.346 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
1.8/5: 36% soul_shard
1:05.085 aoe L incinerate Fluffy_Pillow 49372.0/50000: 99% mana
2.0/5: 40% soul_shard
1:06.826 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.6/5: 52% soul_shard
1:08.566 aoe H havoc enemy2 48872.5/50000: 98% mana
3.1/5: 62% soul_shard
1:09.873 havoc N conflagrate Fluffy_Pillow 48526.0/50000: 97% mana
3.2/5: 64% soul_shard
1:11.181 havoc Q chaos_bolt Fluffy_Pillow 48680.0/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
1:13.007 havoc Q chaos_bolt Fluffy_Pillow 49593.0/50000: 99% mana
2.5/5: 50% soul_shard
1:15.616 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:16.924 havoc N conflagrate Fluffy_Pillow 49253.0/50000: 99% mana
1.1/5: 22% soul_shard
1:18.230 havoc Q chaos_bolt Fluffy_Pillow 49406.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
1:20.056 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:22.945 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:24.685 aoe F immolate enemy3 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
1:25.992 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
1.3/5: 26% soul_shard
1:27.299 aoe F immolate enemy2 48809.0/50000: 98% mana
1.7/5: 34% soul_shard
1:28.605 aoe J conflagrate Fluffy_Pillow 48712.0/50000: 97% mana
1.7/5: 34% soul_shard
1:29.912 aoe K impending_catastrophe Fluffy_Pillow 48865.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:31.652 aoe L incinerate Fluffy_Pillow 47735.5/50000: 95% mana
2.6/5: 52% soul_shard
backdraft
1:32.872 aoe L incinerate Fluffy_Pillow 47345.5/50000: 95% mana
3.0/5: 60% soul_shard
1:34.613 default 9 soul_fire Fluffy_Pillow 47216.0/50000: 94% mana
3.5/5: 70% soul_shard
1:38.091 default A cataclysm Fluffy_Pillow 47955.0/50000: 96% mana
4.9/5: 98% soul_shard
1:39.832 aoe H havoc enemy2 48325.5/50000: 97% mana
5.0/5: 100% soul_shard
1:41.137 havoc Q chaos_bolt Fluffy_Pillow 47978.0/50000: 96% mana
5.0/5: 100% soul_shard
1:43.745 havoc N conflagrate Fluffy_Pillow 49282.0/50000: 99% mana
3.0/5: 60% soul_shard
1:45.051 havoc Q chaos_bolt Fluffy_Pillow 49435.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
1:46.879 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
1:48.186 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.7/5: 74% soul_shard
backdraft
1:50.013 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
1:51.318 havoc N conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.0/5: 40% soul_shard
1:52.624 aoe E channel_demonfire Fluffy_Pillow 49404.5/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
1:55.517 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:56.824 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:58.043 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
1:59.782 aoe F immolate enemy3 48871.5/50000: 98% mana
1.3/5: 26% soul_shard
2:01.087 aoe J conflagrate Fluffy_Pillow 48774.0/50000: 98% mana
1.6/5: 32% soul_shard
2:02.394 aoe F immolate enemy2 48927.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:03.700 aoe F immolate Fluffy_Pillow 48830.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:05.005 aoe L incinerate Fluffy_Pillow 48733.0/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
2:06.225 aoe L incinerate Fluffy_Pillow 48343.0/50000: 97% mana
2.9/5: 58% soul_shard
2:07.966 aoe I rain_of_fire Fluffy_Pillow 48213.5/50000: 96% mana
3.2/5: 64% soul_shard
2:09.272 aoe J conflagrate Fluffy_Pillow 48866.5/50000: 98% mana
0.5/5: 10% soul_shard
2:10.580 default A cataclysm Fluffy_Pillow 49020.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
2:12.320 aoe H havoc enemy2 49390.5/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:13.626 havoc R incinerate Fluffy_Pillow 49043.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:14.845 havoc Q chaos_bolt Fluffy_Pillow 48653.0/50000: 97% mana
2.0/5: 40% soul_shard
2:17.454 havoc R incinerate Fluffy_Pillow 49957.5/50000: 100% mana
0.4/5: 8% soul_shard
2:19.194 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
2:20.499 havoc Q chaos_bolt Fluffy_Pillow 49154.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:22.327 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.633 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.6/5: 12% soul_shard
2:27.112 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
2:29.914 aoe J conflagrate Fluffy_Pillow 49654.0/50000: 99% mana
2.5/5: 50% soul_shard
2:31.219 aoe F immolate enemy3 49806.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
2:32.527 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
2:33.832 aoe K impending_catastrophe Fluffy_Pillow 49905.5/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
2:35.570 aoe L incinerate Fluffy_Pillow 48001.0/50000: 96% mana
0.6/5: 12% soul_shard
backdraft
2:36.791 aoe J conflagrate Fluffy_Pillow 47611.5/50000: 95% mana
1.0/5: 20% soul_shard
2:38.096 aoe F immolate enemy2 47764.0/50000: 96% mana
1.7/5: 34% soul_shard
backdraft
2:39.402 aoe L incinerate Fluffy_Pillow 47667.0/50000: 95% mana
1.8/5: 36% soul_shard
backdraft
2:40.622 aoe L incinerate Fluffy_Pillow 47277.0/50000: 95% mana
2.2/5: 44% soul_shard
2:42.363 default A cataclysm Fluffy_Pillow 47147.5/50000: 94% mana
2.6/5: 52% soul_shard
2:44.106 aoe H havoc enemy2 47519.0/50000: 95% mana
2.7/5: 54% soul_shard
2:45.413 havoc N conflagrate Fluffy_Pillow 47172.5/50000: 94% mana
3.0/5: 60% soul_shard
2:46.722 havoc Q chaos_bolt Fluffy_Pillow 47327.0/50000: 95% mana
4.0/5: 80% soul_shard
backdraft
2:48.549 havoc Q chaos_bolt Fluffy_Pillow 48240.5/50000: 96% mana
2.3/5: 46% soul_shard
2:51.158 havoc R incinerate Fluffy_Pillow 49545.0/50000: 99% mana
0.6/5: 12% soul_shard
2:52.899 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
2:54.205 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:55.510 aoe E channel_demonfire Fluffy_Pillow 49058.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
2:58.285 aoe I rain_of_fire Fluffy_Pillow 49695.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
2:59.591 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.0/5: 0% soul_shard
backdraft
3:00.809 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.5/5: 10% soul_shard
3:02.114 aoe L incinerate Fluffy_Pillow 49154.0/50000: 98% mana
1.0/5: 20% soul_shard
backdraft
3:03.332 aoe F immolate enemy3 48763.0/50000: 98% mana
1.4/5: 28% soul_shard
3:04.640 cds M summon_infernal Fluffy_Pillow 48667.0/50000: 97% mana
1.5/5: 30% soul_shard
3:05.948 aoe L incinerate Fluffy_Pillow 48321.0/50000: 97% mana
2.0/5: 40% soul_shard
3:07.687 aoe L incinerate Fluffy_Pillow 48190.5/50000: 96% mana
2.9/5: 58% soul_shard
3:09.428 aoe D rain_of_fire Fluffy_Pillow 48061.0/50000: 96% mana
3.6/5: 72% soul_shard
3:10.734 aoe J conflagrate Fluffy_Pillow 48714.0/50000: 97% mana
1.0/5: 20% soul_shard
3:12.040 default 9 soul_fire Fluffy_Pillow 48867.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:15.583 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
backdraft
3:17.324 aoe E channel_demonfire Fluffy_Pillow 49372.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
3:20.150 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
3:21.457 havoc Q chaos_bolt Fluffy_Pillow 49653.5/50000: 99% mana
5.0/5: 100% soul_shard
3:24.067 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.375 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.202 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.510 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:29.814 havoc Q chaos_bolt Fluffy_Pillow 49251.0/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
3:31.640 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.1/5: 62% soul_shard
3:32.947 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:34.688 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
3:35.995 aoe F immolate enemy3 49156.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:37.301 aoe K impending_catastrophe Fluffy_Pillow 49059.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
3:39.042 aoe E channel_demonfire Fluffy_Pillow 47929.5/50000: 96% mana
2.4/5: 48% soul_shard
backdraft
3:41.875 aoe F immolate Fluffy_Pillow 48596.0/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
3:43.183 aoe F immolate enemy2 48500.0/50000: 97% mana
2.8/5: 56% soul_shard
backdraft
3:44.490 aoe I rain_of_fire Fluffy_Pillow 48403.5/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
3:45.797 aoe J conflagrate Fluffy_Pillow 49057.0/50000: 98% mana
0.0/5: 0% soul_shard
3:47.104 default A cataclysm Fluffy_Pillow 49210.5/50000: 98% mana
0.8/5: 16% soul_shard
backdraft
3:49.060 aoe L incinerate Fluffy_Pillow 49502.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
3:50.280 aoe H havoc enemy2 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
3:51.587 havoc N conflagrate Fluffy_Pillow 48656.0/50000: 97% mana
1.4/5: 28% soul_shard
3:52.894 havoc Q chaos_bolt Fluffy_Pillow 48809.5/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:54.720 havoc R incinerate Fluffy_Pillow 49722.5/50000: 99% mana
0.8/5: 16% soul_shard
3:56.458 havoc R incinerate Fluffy_Pillow 49001.0/50000: 98% mana
1.4/5: 28% soul_shard
3:58.199 havoc Q chaos_bolt Fluffy_Pillow 48871.5/50000: 98% mana
2.0/5: 40% soul_shard
4:00.809 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
4:02.116 default 9 soul_fire Fluffy_Pillow 49252.5/50000: 99% mana
0.4/5: 8% soul_shard
4:05.593 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
4:08.365 aoe F immolate enemy3 49638.0/50000: 99% mana
2.3/5: 46% soul_shard
4:09.670 aoe J conflagrate Fluffy_Pillow 49251.5/50000: 99% mana
2.4/5: 48% soul_shard
4:10.977 aoe I rain_of_fire Fluffy_Pillow 49405.0/50000: 99% mana
3.1/5: 62% soul_shard
backdraft
4:12.284 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.2/5: 4% soul_shard
backdraft
4:13.502 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
0.6/5: 12% soul_shard
4:14.809 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:16.027 aoe L incinerate Fluffy_Pillow 48764.0/50000: 98% mana
1.7/5: 34% soul_shard
4:17.769 aoe J conflagrate Fluffy_Pillow 48635.0/50000: 97% mana
2.1/5: 42% soul_shard
4:19.076 default A cataclysm Fluffy_Pillow 48788.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
4:20.817 aoe H havoc enemy2 49159.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:22.126 havoc Q chaos_bolt Fluffy_Pillow 48813.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:23.954 havoc R incinerate Fluffy_Pillow 49727.5/50000: 99% mana
1.6/5: 32% soul_shard
4:25.693 havoc Q chaos_bolt Fluffy_Pillow 49001.5/50000: 98% mana
2.1/5: 42% soul_shard
4:28.301 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:30.041 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.0/5: 20% soul_shard
4:31.349 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
4:32.655 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:35.384 aoe L incinerate Fluffy_Pillow 49673.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:36.603 aoe I rain_of_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.0/5: 60% soul_shard
4:37.910 aoe J conflagrate Fluffy_Pillow 49655.5/50000: 99% mana
0.1/5: 2% soul_shard
4:39.216 aoe F immolate enemy3 49808.5/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:40.523 aoe K impending_catastrophe Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
backdraft
4:42.264 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.1/5: 22% soul_shard
backdraft
4:43.483 aoe J conflagrate Fluffy_Pillow 47612.0/50000: 95% mana
1.5/5: 30% soul_shard
4:44.790 aoe L incinerate Fluffy_Pillow 47765.5/50000: 96% mana
2.2/5: 44% soul_shard
backdraft
4:46.011 aoe F immolate enemy2 47376.0/50000: 95% mana
2.7/5: 54% soul_shard
4:47.319 aoe L incinerate Fluffy_Pillow 47280.0/50000: 95% mana
2.8/5: 56% soul_shard
4:49.058 aoe I rain_of_fire Fluffy_Pillow 47149.5/50000: 94% mana
3.2/5: 64% soul_shard
4:50.364 default 9 soul_fire Fluffy_Pillow 47802.5/50000: 96% mana
0.3/5: 6% soul_shard
4:54.065 default A cataclysm Fluffy_Pillow 48653.0/50000: 97% mana
1.8/5: 36% soul_shard
4:55.804 aoe E channel_demonfire Fluffy_Pillow 49022.5/50000: 98% mana
1.9/5: 38% soul_shard
4:58.712 aoe H havoc enemy2 49726.5/50000: 99% mana
2.3/5: 46% soul_shard
5:00.019 havoc N conflagrate Fluffy_Pillow 49380.0/50000: 99% mana
2.4/5: 48% soul_shard
5:01.324 havoc Q chaos_bolt Fluffy_Pillow 49532.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
5:03.154 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
5:04.458 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
5:06.284 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.1/5: 22% soul_shard
5:07.590 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
5:09.330 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.9/5: 38% soul_shard
5:10.695 aoe I rain_of_fire Fluffy_Pillow 49184.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
5:12.000 aoe L incinerate Fluffy_Pillow 49837.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
5:13.219 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.7/5: 14% soul_shard
5:14.959 aoe F immolate enemy3 48872.0/50000: 98% mana
1.1/5: 22% soul_shard

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_CataOrigin"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=219:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_CombustingEngine : 9547 dps, 5092 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9546.8 9546.8 16.9 / 0.177% 830.6 / 8.7% 20.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.2 406.8 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_CombustingEngine 9547
Cataclysm 773 8.1% 9.6 32.47sec 23959 14104 Direct 28.8 6701 13407 7987 19.2%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.60 28.79 0.00 0.00 1.6988 0.0000 229938.53 229938.53 0.00% 14104.06 14104.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 23.27 15 33 6700.85 6142 7261 6699.95 6504 6908 155904 155904 0.00%
crit 19.18% 5.52 1 15 13406.55 12283 14521 13414.44 12346 14427 74035 74035 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.67
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1028) 0.0% (10.8%) 12.2 25.15sec 25120 9327

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.16 0.00 181.63 0.00 2.6933 0.1635 0.00 0.00 0.00% 9327.04 9327.04

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.16
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1028 10.8% 0.0 0.00sec 0 0 Direct 544.9 471 938 560 19.2%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 544.90 0.00 0.00 0.0000 0.0000 305385.82 305385.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 440.22 320 568 470.59 263 976 470.87 440 500 207177 207177 0.00%
crit 19.21% 104.69 65 160 938.14 525 1952 938.81 802 1104 98209 98209 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1280 (1808) 13.4% (18.9%) 22.4 12.83sec 23921 12173 Direct 44.6 (88.8) 0 8523 8523 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.42 44.58 0.00 0.00 1.9651 0.0000 379986.69 379986.69 0.00% 12172.81 12172.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.58 30 60 8522.74 5861 11548 8522.90 8306 8735 379987 379987 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.52
  • if_expr:cast_time<havoc_remains
    Internal Combustion 527 5.5% 44.2 12.83sec 3538 0 Direct 44.2 2960 5947 3538 19.3%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 0.0000 0.0000 156371.46 156371.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.65% 35.65 20 54 2960.13 1 4607 2960.15 2590 3227 105499 105499 0.00%
crit 19.35% 8.55 1 21 5947.04 2 9207 5943.94 4509 7361 50872 50872 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.4% 36.8 7.94sec 6483 5189 Direct 55.3 3615 7237 4305 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.76 55.35 0.00 0.00 1.2494 0.0000 238345.02 238345.02 0.00% 5189.08 5189.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.90% 44.78 30 61 3614.61 2047 5042 3614.41 3416 3863 161797 161797 0.00%
crit 19.10% 10.57 3 22 7236.77 4095 10084 7238.36 5480 9230 76548 76548 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.22
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.54
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1696 17.8% 27.9 10.22sec 18063 14296 Direct 34.8 1538 3090 1838 19.4%
Periodic 343.2 1076 2149 1283 19.3% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.92 34.78 343.16 343.16 1.2635 2.4813 504350.20 504350.20 0.00% 568.76 14295.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 28.04 18 41 1537.59 819 2017 1537.13 1413 1651 43095 43095 0.00%
crit 19.37% 6.74 0 14 3090.38 1640 4032 3087.22 0 3897 20845 20845 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.67% 276.82 212 349 1075.90 1 1714 1075.90 1047 1099 297826 297826 0.00%
crit 19.33% 66.35 39 99 2149.05 9 3427 2149.36 1996 2310 142584 142584 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.81
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.21
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (227) 0.0% (2.4%) 4.7 64.88sec 14455 8736

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 1.6547 0.0000 0.00 0.00 0.00% 8735.90 8735.90

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.69
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 663 18.9%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.86 0.00 0.00 0.0000 0.0000 9196.54 9196.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 11.24 4 18 558.02 558 558 558.02 558 558 6271 6271 0.00%
crit 18.91% 2.62 0 8 1116.04 1116 1116 1043.81 0 1116 2926 2926 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 196 2.1% 0.0 0.00sec 0 0 Periodic 100.9 484 967 577 19.4% 18.2%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 100.86 100.86 0.0000 1.6126 58235.90 58235.90 0.00% 358.06 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.61% 81.30 63 113 483.61 446 488 483.62 482 486 39317 39317 0.00%
crit 19.39% 19.56 6 35 967.27 891 977 967.26 941 977 18918 18918 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 545 5.7% 41.4 6.60sec 3927 2684 Direct 52.3 (52.3) 2606 5241 3114 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.43 52.30 0.00 0.00 1.4632 0.0000 162710.70 162710.70 0.00% 2684.24 2684.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 42.26 23 64 2606.11 1312 3232 2607.24 2386 2808 110115 110115 0.00%
crit 19.19% 10.03 2 22 5240.95 2624 6464 5241.99 3754 6256 52596 52596 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.44
    havoc
    [R]:11.23
  • if_expr:cast_time<havoc_remains
Rain of Fire 857 9.0% 16.3 17.62sec 15619 12513 Periodic 386.8 553 1105 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.32 0.00 0.00 386.79 1.2482 0.0000 254879.50 254879.50 0.00% 12513.11 12513.11
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 312.50 207 428 552.79 507 599 552.78 546 561 172752 172752 0.00%
crit 19.21% 74.29 36 110 1105.44 1013 1198 1105.33 1085 1126 82128 82128 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.13
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.19
Soul Fire 498 5.2% 5.5 49.49sec 26806 7709 Direct 7.5 16720 34031 19801 17.7%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.51 7.47 0.00 0.00 3.4775 0.0000 147821.70 147821.70 0.00% 7708.68 7708.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.28% 6.15 2 10 16719.65 8604 21176 16742.46 12804 19414 102748 102748 0.00%
crit 17.72% 1.32 0 5 34030.88 17356 42321 25637.78 0 42313 45074 45074 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.59
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.03
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.8% 2.0 180.56sec 12014 10388 Direct 6.0 3348 6696 4006 19.6%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 24027.47 24027.47 0.00% 10388.01 10388.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.39% 4.82 1 6 3348.13 3348 3348 3348.13 3348 3348 16150 16150 0.00%
crit 19.61% 1.18 0 5 6696.27 6696 6696 4789.24 0 6696 7877 7877 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3511 / 718
Immolation 3246 6.9% 39.0 5.49sec 4994 0 Direct 117.0 1395 2790 1665 19.3%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194748.05 194748.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 94.40 82 106 1395.06 1395 1395 1395.06 1395 1395 131695 131695 0.00%
crit 19.32% 22.60 11 35 2790.11 2790 2790 2790.11 2790 2790 63053 63053 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.4%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15933.62 22759.58 29.99% 270.50 270.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 33.06 25 39 325.55 326 326 325.55 326 326 10762 15372 29.99%
crit 19.37% 7.94 2 16 651.10 651 651 651.10 651 651 5172 7388 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1651 1134 Direct 91.9 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152857.98 152857.98 0.00% 1134.04 1134.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 74.18 54 96 1395.06 1395 1395 1395.06 1395 1395 103480 103480 0.00%
crit 19.26% 17.70 4 30 2790.11 2790 2790 2790.11 2790 2790 49378 49378 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Venthyr_CombustingEngine
Havoc 9.6 32.28sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.55 0.00 0.00 0.00 1.2437 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.56
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.4sec 54.04% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.4s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.04%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_CombustingEngine_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 184.5s
  • trigger_min/max:180.0s / 184.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.6sec 180.6sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_CombustingEngine_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 184.5s
  • trigger_min/max:180.0s / 184.5s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.54% 8.78% 13.97% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_CombustingEngine
soul_fire Soul Shard 6.52 7.19 7.73% 1.10 0.35 4.62%
immolate Soul Shard 343.23 33.10 35.60% 0.10 1.23 3.57%
incinerate Soul Shard 41.44 10.51 11.31% 0.25 0.01 0.05%
conflagrate Soul Shard 36.76 27.66 29.76% 0.75 0.00 0.00%
mana_regen Mana 651.81 121096.93 100.00% 185.79 27426.28 18.47%
immolate_crits Soul Shard 33.19 3.20 3.45% 0.10 0.11 3.45%
incinerate_crits Soul Shard 10.08 1.01 1.08% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.28 11.06% 0.09 1.72 14.33%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.83 410.21 27438.5 48993.3 47006.0 50000.0
Soul Shard 4.0 0.31 0.32 3.4 2.1 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_CombustingEngine
cataclysm Mana 9.6 4803.6 500.0 500.5 47.9
channel_demonfire Mana 12.2 9120.7 750.0 750.2 33.5
chaos_bolt Soul Shard 22.4 44.8 2.0 2.0 11969.4
conflagrate Mana 36.8 18379.3 500.0 499.9 13.0
havoc Mana 9.6 9561.5 1000.0 1001.0 0.0
immolate Mana 27.9 20936.1 750.0 749.8 24.1
impending_catastrophe Mana 4.7 9343.8 2000.0 2002.9 7.2
incinerate Mana 41.4 41444.8 1000.0 1000.4 3.9
rain_of_fire Soul Shard 16.3 49.0 3.0 3.0 5205.3
soul_fire Mana 6.5 6523.7 1000.0 1183.0 22.7
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_CombustingEngine Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Venthyr_CombustingEngine Damage Per Second
Count 618
Mean 9546.83
Minimum 9006.81
Maximum 10132.01
Spread ( max - min ) 1125.20
Range [ ( max - min ) / 2 * 100% ] 5.89%
Standard Deviation 214.1458
5th Percentile 9209.16
95th Percentile 9919.86
( 95th Percentile - 5th Percentile ) 710.70
Mean Distribution
Standard Deviation 8.6142
95.00% Confidence Interval ( 9529.95 - 9563.72 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1933
0.1 Scale Factor Error with Delta=300 392
0.05 Scale Factor Error with Delta=300 1566
0.01 Scale Factor Error with Delta=300 39148
Priority Target DPS
Venthyr_CombustingEngine Priority Target Damage Per Second
Count 618
Mean 5092.24
Minimum 4753.14
Maximum 5549.43
Spread ( max - min ) 796.29
Range [ ( max - min ) / 2 * 100% ] 7.82%
Standard Deviation 123.8665
5th Percentile 4897.22
95th Percentile 5313.65
( 95th Percentile - 5th Percentile ) 416.44
Mean Distribution
Standard Deviation 4.9826
95.00% Confidence Interval ( 5082.48 - 5102.01 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2273
0.1 Scale Factor Error with Delta=300 131
0.05 Scale Factor Error with Delta=300 524
0.01 Scale Factor Error with Delta=300 13098
DPS(e)
Venthyr_CombustingEngine Damage Per Second (Effective)
Count 618
Mean 9546.83
Minimum 9006.81
Maximum 10132.01
Spread ( max - min ) 1125.20
Range [ ( max - min ) / 2 * 100% ] 5.89%
Damage
Venthyr_CombustingEngine Damage
Count 618
Mean 2471249.51
Minimum 1966120.87
Maximum 2978435.53
Spread ( max - min ) 1012314.66
Range [ ( max - min ) / 2 * 100% ] 20.48%
DTPS
Venthyr_CombustingEngine Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_CombustingEngine Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_CombustingEngine Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_CombustingEngine Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_CombustingEngine Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_CombustingEngine Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_CombustingEngineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_CombustingEngine Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.59 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.67 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.13 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.16 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.81 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.56 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.19 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.22 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.69 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.44 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.54 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.03 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.21 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.52 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 11.23 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRPNQ9FJLEFIJLALJHQQRNPQELFJFFKLIJA9HQNQRRNPEFFILJLLILAJHRQRNPQE9FJIKFLJLAHNQQRNPELILFJLMLDJLLA9EHQNQNPQDFJKLFEJAILLHNQRPQRN9EFIJLLAJIHRRNQRQPEFFJKLJLILAHNOQQNELIFFFJL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.739 aoe E channel_demonfire Fluffy_Pillow 49369.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.950 cds M summon_infernal Fluffy_Pillow 49725.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.955 aoe H havoc enemy2 49227.5/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.963 havoc Q chaos_bolt Fluffy_Pillow 48731.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.972 havoc N conflagrate Fluffy_Pillow 49736.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.980 havoc Q chaos_bolt Fluffy_Pillow 49740.0/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.388 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.393 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.398 havoc Q chaos_bolt Fluffy_Pillow 49251.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.805 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.811 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.217 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.226 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.232 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.641 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.647 aoe F immolate enemy2 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.653 aoe F immolate enemy3 49005.0/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.658 aoe D rain_of_fire Fluffy_Pillow 48757.5/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.665 aoe K impending_catastrophe Fluffy_Pillow 49261.0/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.004 aoe L incinerate Fluffy_Pillow 47930.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:26.942 aoe J conflagrate Fluffy_Pillow 47399.5/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust
0:27.947 aoe L incinerate Fluffy_Pillow 47402.0/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:28.887 aoe J conflagrate Fluffy_Pillow 46872.0/50000: 94% mana
2.9/5: 58% soul_shard
bloodlust
0:29.894 aoe D rain_of_fire Fluffy_Pillow 46875.5/50000: 94% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:30.901 aoe L incinerate Fluffy_Pillow 47379.0/50000: 95% mana
1.2/5: 24% soul_shard
bloodlust, backdraft
0:31.840 default A cataclysm Fluffy_Pillow 46848.5/50000: 94% mana
1.8/5: 36% soul_shard
bloodlust
0:33.180 aoe L incinerate Fluffy_Pillow 47018.5/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:34.521 aoe J conflagrate Fluffy_Pillow 46689.0/50000: 93% mana
2.8/5: 56% soul_shard
bloodlust
0:35.591 aoe E channel_demonfire Fluffy_Pillow 46724.0/50000: 93% mana
3.4/5: 68% soul_shard
bloodlust, backdraft
0:37.730 aoe H havoc enemy2 47043.5/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.736 havoc Q chaos_bolt Fluffy_Pillow 46546.5/50000: 93% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:40.142 havoc Q chaos_bolt Fluffy_Pillow 47249.5/50000: 94% mana
2.2/5: 44% soul_shard
bloodlust
0:42.150 havoc R incinerate Fluffy_Pillow 48253.5/50000: 97% mana
0.5/5: 10% soul_shard
0:43.890 havoc P immolate Fluffy_Pillow 48123.5/50000: 96% mana
1.0/5: 20% soul_shard
0:45.195 havoc N conflagrate Fluffy_Pillow 48026.0/50000: 96% mana
1.2/5: 24% soul_shard
0:46.502 havoc Q chaos_bolt Fluffy_Pillow 48179.5/50000: 96% mana
2.3/5: 46% soul_shard
backdraft
0:48.329 default 9 soul_fire Fluffy_Pillow 49093.0/50000: 98% mana
0.7/5: 14% soul_shard
0:51.808 aoe F immolate enemy3 49003.0/50000: 98% mana
2.0/5: 40% soul_shard
0:53.114 aoe J conflagrate Fluffy_Pillow 48906.0/50000: 98% mana
2.4/5: 48% soul_shard
0:54.420 aoe L incinerate Fluffy_Pillow 49059.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:55.641 aoe E channel_demonfire Fluffy_Pillow 48669.5/50000: 97% mana
3.3/5: 66% soul_shard
0:58.470 aoe F immolate enemy2 49334.0/50000: 99% mana
3.7/5: 74% soul_shard
0:59.776 aoe I rain_of_fire Fluffy_Pillow 49237.0/50000: 98% mana
3.8/5: 76% soul_shard
1:01.082 aoe J conflagrate Fluffy_Pillow 49890.0/50000: 100% mana
1.0/5: 20% soul_shard
1:02.388 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
backdraft
1:03.607 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.2/5: 44% soul_shard
1:05.347 aoe L incinerate Fluffy_Pillow 49372.0/50000: 99% mana
2.6/5: 52% soul_shard
1:07.089 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
2.8/5: 56% soul_shard
1:08.563 aoe H havoc enemy2 49240.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
1:09.869 havoc Q chaos_bolt Fluffy_Pillow 48893.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
1:11.696 havoc Q chaos_bolt Fluffy_Pillow 49806.5/50000: 100% mana
2.1/5: 42% soul_shard
1:14.306 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
1:16.046 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
1:17.352 havoc P immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:18.660 havoc Q chaos_bolt Fluffy_Pillow 49059.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:20.486 aoe E channel_demonfire Fluffy_Pillow 49972.0/50000: 100% mana
0.5/5: 10% soul_shard
1:23.353 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:25.093 aoe F immolate enemy3 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
1:26.400 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.7/5: 34% soul_shard
1:27.708 aoe F immolate enemy2 49059.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
1:29.012 aoe F immolate Fluffy_Pillow 48961.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:30.318 aoe K impending_catastrophe Fluffy_Pillow 48864.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
1:32.058 aoe L incinerate Fluffy_Pillow 47734.5/50000: 95% mana
2.8/5: 56% soul_shard
backdraft
1:33.279 aoe I rain_of_fire Fluffy_Pillow 47345.0/50000: 95% mana
3.0/5: 60% soul_shard
1:34.584 aoe J conflagrate Fluffy_Pillow 47997.5/50000: 96% mana
0.4/5: 8% soul_shard
1:35.891 default A cataclysm Fluffy_Pillow 48151.0/50000: 96% mana
0.9/5: 18% soul_shard
backdraft
1:37.630 default 9 soul_fire Fluffy_Pillow 48520.5/50000: 97% mana
1.2/5: 24% soul_shard
backdraft
1:41.107 aoe H havoc enemy2 49002.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
1:42.413 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
1:44.240 havoc N conflagrate Fluffy_Pillow 49568.5/50000: 99% mana
1.1/5: 22% soul_shard
1:45.548 havoc Q chaos_bolt Fluffy_Pillow 49722.5/50000: 99% mana
2.2/5: 44% soul_shard
backdraft
1:47.375 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:49.116 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
1:50.856 havoc N conflagrate Fluffy_Pillow 48872.5/50000: 98% mana
1.9/5: 38% soul_shard
1:52.162 havoc P immolate Fluffy_Pillow 49025.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
1:53.469 aoe E channel_demonfire Fluffy_Pillow 48929.0/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
1:56.332 aoe F immolate enemy2 49610.5/50000: 99% mana
3.6/5: 72% soul_shard
backdraft
1:57.637 aoe F immolate enemy3 49251.5/50000: 99% mana
3.8/5: 76% soul_shard
backdraft
1:58.942 aoe I rain_of_fire Fluffy_Pillow 49154.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
2:00.250 aoe L incinerate Fluffy_Pillow 49808.0/50000: 100% mana
1.1/5: 22% soul_shard
backdraft
2:01.469 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.3/5: 26% soul_shard
2:02.775 aoe L incinerate Fluffy_Pillow 49155.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:03.993 aoe L incinerate Fluffy_Pillow 48764.0/50000: 98% mana
2.5/5: 50% soul_shard
2:05.733 aoe I rain_of_fire Fluffy_Pillow 48634.0/50000: 97% mana
3.0/5: 60% soul_shard
2:07.039 aoe L incinerate Fluffy_Pillow 49287.0/50000: 99% mana
0.0/5: 0% soul_shard
2:08.780 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
0.5/5: 10% soul_shard
2:10.522 aoe J conflagrate Fluffy_Pillow 49373.5/50000: 99% mana
0.7/5: 14% soul_shard
2:11.829 aoe H havoc enemy2 49527.0/50000: 99% mana
1.3/5: 26% soul_shard
backdraft
2:13.134 havoc R incinerate Fluffy_Pillow 49179.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
2:14.354 havoc Q chaos_bolt Fluffy_Pillow 48789.5/50000: 98% mana
2.0/5: 40% soul_shard
2:16.964 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:18.705 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
2:20.011 havoc P immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:21.317 havoc Q chaos_bolt Fluffy_Pillow 49058.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:23.146 aoe E channel_demonfire Fluffy_Pillow 49973.0/50000: 100% mana
0.5/5: 10% soul_shard
2:25.989 default 9 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
2:29.580 aoe F immolate enemy3 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
2:30.886 aoe J conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.5/5: 50% soul_shard
2:32.192 aoe I rain_of_fire Fluffy_Pillow 49058.0/50000: 98% mana
3.4/5: 68% soul_shard
backdraft
2:33.500 aoe K impending_catastrophe Fluffy_Pillow 49712.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
2:35.241 aoe F immolate enemy2 48002.5/50000: 96% mana
0.8/5: 16% soul_shard
backdraft
2:36.548 aoe L incinerate Fluffy_Pillow 47906.0/50000: 96% mana
1.0/5: 20% soul_shard
backdraft
2:37.768 aoe J conflagrate Fluffy_Pillow 47516.0/50000: 95% mana
1.3/5: 26% soul_shard
2:39.074 aoe L incinerate Fluffy_Pillow 47669.0/50000: 95% mana
2.1/5: 42% soul_shard
backdraft
2:40.291 default A cataclysm Fluffy_Pillow 47277.5/50000: 95% mana
2.4/5: 48% soul_shard
2:42.256 aoe H havoc enemy2 47760.0/50000: 96% mana
2.7/5: 54% soul_shard
2:43.562 havoc N conflagrate Fluffy_Pillow 47413.0/50000: 95% mana
2.7/5: 54% soul_shard
2:44.869 havoc Q chaos_bolt Fluffy_Pillow 47566.5/50000: 95% mana
4.1/5: 82% soul_shard
backdraft
2:46.696 havoc Q chaos_bolt Fluffy_Pillow 48480.0/50000: 97% mana
2.1/5: 42% soul_shard
2:49.305 havoc R incinerate Fluffy_Pillow 49784.5/50000: 100% mana
0.4/5: 8% soul_shard
2:51.047 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
2:52.354 havoc P immolate Fluffy_Pillow 49156.5/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:53.661 aoe E channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:56.541 aoe L incinerate Fluffy_Pillow 49750.0/50000: 100% mana
2.9/5: 58% soul_shard
backdraft
2:57.759 aoe I rain_of_fire Fluffy_Pillow 49001.5/50000: 98% mana
3.4/5: 68% soul_shard
2:59.066 aoe L incinerate Fluffy_Pillow 49655.0/50000: 99% mana
0.4/5: 8% soul_shard
3:00.805 aoe F immolate enemy3 49001.5/50000: 98% mana
0.9/5: 18% soul_shard
3:02.113 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
0.9/5: 18% soul_shard
3:03.422 aoe L incinerate Fluffy_Pillow 49060.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:04.642 cds M summon_infernal Fluffy_Pillow 48670.0/50000: 97% mana
1.9/5: 38% soul_shard
3:05.948 aoe L incinerate Fluffy_Pillow 48323.0/50000: 97% mana
2.5/5: 50% soul_shard
3:07.690 aoe D rain_of_fire Fluffy_Pillow 48194.0/50000: 96% mana
3.4/5: 68% soul_shard
3:08.998 aoe J conflagrate Fluffy_Pillow 48848.0/50000: 98% mana
0.7/5: 14% soul_shard
3:10.305 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:11.524 aoe L incinerate Fluffy_Pillow 48611.0/50000: 97% mana
2.2/5: 44% soul_shard
3:13.266 default A cataclysm Fluffy_Pillow 48482.0/50000: 97% mana
3.1/5: 62% soul_shard
3:15.007 default 9 soul_fire Fluffy_Pillow 48852.5/50000: 98% mana
3.6/5: 72% soul_shard
3:18.484 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
5.0/5: 100% soul_shard
3:21.298 aoe H havoc enemy2 49659.0/50000: 99% mana
5.0/5: 100% soul_shard
3:22.605 havoc Q chaos_bolt Fluffy_Pillow 49312.5/50000: 99% mana
5.0/5: 100% soul_shard
3:25.213 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.520 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:28.346 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:29.653 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:30.960 havoc Q chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.8/5: 96% soul_shard
backdraft
3:32.786 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:34.091 aoe F immolate enemy3 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:35.397 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
3:36.703 aoe K impending_catastrophe Fluffy_Pillow 49405.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
3:38.443 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
1.6/5: 32% soul_shard
backdraft
3:39.664 aoe F immolate enemy2 47612.5/50000: 95% mana
2.1/5: 42% soul_shard
3:40.971 aoe E channel_demonfire Fluffy_Pillow 47516.0/50000: 95% mana
2.1/5: 42% soul_shard
3:43.832 aoe J conflagrate Fluffy_Pillow 48196.5/50000: 96% mana
2.5/5: 50% soul_shard
3:45.140 default A cataclysm Fluffy_Pillow 48350.5/50000: 97% mana
3.2/5: 64% soul_shard
backdraft
3:46.880 aoe I rain_of_fire Fluffy_Pillow 48720.5/50000: 97% mana
3.6/5: 72% soul_shard
backdraft
3:48.186 aoe L incinerate Fluffy_Pillow 49373.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
3:49.406 aoe L incinerate Fluffy_Pillow 48983.5/50000: 98% mana
1.2/5: 24% soul_shard
3:51.147 aoe H havoc enemy2 48854.0/50000: 98% mana
1.6/5: 32% soul_shard
3:52.605 havoc N conflagrate Fluffy_Pillow 48583.0/50000: 97% mana
1.9/5: 38% soul_shard
3:53.911 havoc Q chaos_bolt Fluffy_Pillow 48736.0/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
3:55.739 havoc R incinerate Fluffy_Pillow 49650.0/50000: 99% mana
1.3/5: 26% soul_shard
3:57.479 havoc P immolate Fluffy_Pillow 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
3:58.785 havoc Q chaos_bolt Fluffy_Pillow 48905.0/50000: 98% mana
2.0/5: 40% soul_shard
4:01.395 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:03.137 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.1/5: 22% soul_shard
4:04.444 default 9 soul_fire Fluffy_Pillow 49156.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:07.920 aoe E channel_demonfire Fluffy_Pillow 49001.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
4:10.810 aoe F immolate enemy3 49696.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:12.116 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
4:13.422 aoe J conflagrate Fluffy_Pillow 49905.0/50000: 100% mana
1.4/5: 28% soul_shard
4:14.729 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
4:15.948 aoe L incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.4/5: 48% soul_shard
4:17.687 default A cataclysm Fluffy_Pillow 48871.5/50000: 98% mana
2.8/5: 56% soul_shard
4:19.428 aoe J conflagrate Fluffy_Pillow 49242.0/50000: 98% mana
2.9/5: 58% soul_shard
4:20.734 aoe I rain_of_fire Fluffy_Pillow 49395.0/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
4:22.040 aoe H havoc enemy2 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
backdraft
4:23.345 havoc R incinerate Fluffy_Pillow 49652.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
4:24.565 havoc R incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
4:26.304 havoc N conflagrate Fluffy_Pillow 48872.0/50000: 98% mana
2.0/5: 40% soul_shard
4:27.611 havoc Q chaos_bolt Fluffy_Pillow 49025.5/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
4:29.439 havoc R incinerate Fluffy_Pillow 49939.5/50000: 100% mana
1.4/5: 28% soul_shard
4:31.180 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
4:33.790 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:35.096 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.4/5: 8% soul_shard
4:37.886 aoe F immolate enemy3 49897.0/50000: 100% mana
0.7/5: 14% soul_shard
4:39.193 aoe F immolate enemy2 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:40.499 aoe J conflagrate Fluffy_Pillow 49155.5/50000: 98% mana
0.9/5: 18% soul_shard
4:41.804 aoe K impending_catastrophe Fluffy_Pillow 49308.0/50000: 99% mana
1.6/5: 32% soul_shard
backdraft
4:43.545 aoe L incinerate Fluffy_Pillow 48002.5/50000: 96% mana
1.8/5: 36% soul_shard
backdraft
4:44.765 aoe J conflagrate Fluffy_Pillow 47612.5/50000: 95% mana
2.1/5: 42% soul_shard
4:46.071 aoe L incinerate Fluffy_Pillow 47765.5/50000: 96% mana
2.8/5: 56% soul_shard
backdraft
4:47.290 aoe I rain_of_fire Fluffy_Pillow 47375.0/50000: 95% mana
3.1/5: 62% soul_shard
4:48.597 aoe L incinerate Fluffy_Pillow 48028.5/50000: 96% mana
0.3/5: 6% soul_shard
4:50.338 default A cataclysm Fluffy_Pillow 47899.0/50000: 96% mana
0.6/5: 12% soul_shard
4:52.081 aoe H havoc enemy2 48270.5/50000: 97% mana
1.0/5: 20% soul_shard
4:53.386 havoc N conflagrate Fluffy_Pillow 47923.0/50000: 96% mana
1.0/5: 20% soul_shard
4:54.694 havoc O soul_fire Fluffy_Pillow 48077.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft
4:58.171 havoc Q chaos_bolt Fluffy_Pillow 48815.5/50000: 98% mana
4.6/5: 92% soul_shard
backdraft
4:59.998 havoc Q chaos_bolt Fluffy_Pillow 49729.0/50000: 99% mana
2.9/5: 58% soul_shard
5:02.608 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
5:03.915 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
5:06.727 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
backdraft
5:07.947 aoe I rain_of_fire Fluffy_Pillow 49002.5/50000: 98% mana
3.2/5: 64% soul_shard
5:09.254 aoe F immolate enemy2 49656.0/50000: 99% mana
0.3/5: 6% soul_shard
5:10.561 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
0.5/5: 10% soul_shard
5:11.868 aoe F immolate enemy3 49156.0/50000: 98% mana
0.6/5: 12% soul_shard
5:13.174 aoe J conflagrate Fluffy_Pillow 49059.0/50000: 98% mana
0.8/5: 16% soul_shard
5:14.480 aoe L incinerate Fluffy_Pillow 49212.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_CombustingEngine"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=212:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_DuplicitousHavoc : 9616 dps, 5008 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9616.4 9616.4 16.3 / 0.170% 773.1 / 8.0% 20.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.3 406.8 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_DuplicitousHavoc 9616
Cataclysm 775 8.1% 9.6 32.41sec 24031 14147 Direct 28.8 6698 13409 8006 19.6%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.60 28.79 0.00 0.00 1.6988 0.0000 230631.04 230631.04 0.00% 14146.54 14146.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 23.16 13 35 6698.03 6141 7261 6698.36 6487 6884 155115 155115 0.00%
crit 19.56% 5.63 0 12 13408.55 12283 14519 13358.20 0 14395 75516 75516 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.67
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1031) 0.0% (10.7%) 12.2 25.23sec 25167 9353

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.17 0.00 181.70 0.00 2.6909 0.1634 0.00 0.00 0.00% 9352.61 9352.61

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.17
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1031 10.7% 0.0 0.00sec 0 0 Direct 545.1 471 941 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 545.10 0.00 0.00 0.0000 0.0000 306316.82 306316.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 439.76 317 557 471.05 263 976 471.35 444 497 207140 207140 0.00%
crit 19.33% 105.34 68 153 941.43 525 1952 941.98 808 1093 99176 99176 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1405 (1874) 14.6% (19.5%) 22.5 12.90sec 24761 12597 Direct 44.7 (89.1) 0 9325 9325 100.0% (59.9%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.47 44.72 0.00 0.00 1.9657 0.0000 417029.11 417029.11 0.00% 12596.85 12596.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.72 32 58 9325.15 7326 11548 9325.19 9122 9574 417029 417029 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.58
  • if_expr:cast_time<havoc_remains
    Internal Combustion 470 4.9% 44.4 12.87sec 3140 0 Direct 44.4 2629 5245 3139 19.6%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.38 44.38 0.00 0.00 0.0000 0.0000 139373.98 139373.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 35.70 25 48 2628.56 1 3715 2629.20 2431 2824 93845 93845 0.00%
crit 19.55% 8.68 2 20 5245.18 2 7430 5242.72 3326 6344 45529 45529 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 847 8.8% 36.8 7.93sec 6851 5483 Direct 55.3 3824 7669 4557 19.1%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.78 55.30 0.00 0.00 1.2494 0.0000 252014.82 252014.82 0.00% 5483.47 5483.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 44.75 31 60 3824.43 2559 5042 3824.61 3649 4028 171143 171143 0.00%
crit 19.07% 10.54 3 22 7668.60 5118 10084 7675.82 6237 8989 80872 80872 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.30
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.48
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1618 16.9% 28.0 10.39sec 17163 13582 Direct 34.9 1592 3176 1899 19.4%
Periodic 343.3 1013 2025 1209 19.4% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 28.04 34.88 343.26 343.26 1.2637 2.4811 481203.50 481203.50 0.00% 542.45 13581.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 28.12 17 43 1592.31 1024 2017 1592.70 1438 1695 44783 44783 0.00%
crit 19.38% 6.76 0 16 3175.78 2048 4034 3169.16 0 3888 21466 21466 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.62% 276.74 216 346 1012.65 1 1261 1012.71 988 1034 280248 280248 0.00%
crit 19.38% 66.52 37 106 2025.19 5 2521 2025.46 1936 2164 134707 134707 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.94
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.18
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (228) 0.0% (2.4%) 4.7 64.88sec 14481 8752

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 1.6548 0.0000 0.00 0.00 0.00% 8751.97 8751.97

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.70
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 664 19.0%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.85 0.00 0.00 0.0000 0.0000 9196.54 9196.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 11.23 4 17 558.02 558 558 558.02 558 558 6266 6266 0.00%
crit 18.96% 2.63 0 8 1116.04 1116 1116 1063.67 0 1116 2931 2931 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 197 2.0% 0.0 0.00sec 0 0 Periodic 101.0 484 967 578 19.5% 18.3%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.02 101.02 0.0000 1.6127 58359.94 58359.94 0.00% 358.21 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.55% 81.37 63 114 483.58 446 488 483.60 482 486 39351 39351 0.00%
crit 19.45% 19.65 9 38 967.34 891 977 967.40 942 977 19009 19009 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 561 5.9% 41.4 6.51sec 4044 2765 Direct 52.0 (52.0) 2696 5380 3218 19.4% (19.4%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.35 51.99 0.00 0.00 1.4626 0.0000 167235.79 167235.79 0.00% 2765.19 2765.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 41.91 26 65 2696.06 1640 3232 2696.84 2448 2861 112988 112988 0.00%
crit 19.39% 10.08 3 20 5379.91 3281 6464 5375.26 3870 6149 54248 54248 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.62
    havoc
    [R]:10.99
  • if_expr:cast_time<havoc_remains
Rain of Fire 851 8.9% 16.2 17.61sec 15599 12497 Periodic 384.0 553 1106 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.22 0.00 0.00 383.97 1.2482 0.0000 253089.36 253089.36 0.00% 12497.01 12497.01
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 310.12 210 430 552.86 507 599 552.86 544 561 171453 171453 0.00%
crit 19.23% 73.84 41 112 1105.58 1013 1198 1105.55 1086 1127 81637 81637 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.14
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.09
Soul Fire 518 5.4% 5.5 49.47sec 27882 8018 Direct 7.5 17141 34291 20429 19.2%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.54 0.00 0.00 3.4775 0.0000 154025.10 154025.10 0.00% 8017.96 8017.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 6.09 2 10 17141.14 10832 21175 17164.72 14743 19759 104434 104434 0.00%
crit 19.19% 1.45 0 5 34290.91 21644 42337 28000.83 0 42248 49591 49591 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.55
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.07
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.39sec 11924 10311 Direct 6.0 3348 6696 3970 18.7%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23848.69 23848.69 0.00% 10310.72 10310.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.28% 4.88 1 6 3348.13 3348 3348 3348.13 3348 3348 16329 16329 0.00%
crit 18.72% 1.12 0 5 6696.27 6696 6696 4745.90 0 6696 7520 7520 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3508 / 717
Immolation 3242 6.8% 39.0 5.49sec 4988 0 Direct 117.0 1395 2790 1662 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194538.11 194538.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 94.55 76 107 1395.06 1395 1395 1395.06 1395 1395 131905 131905 0.00%
crit 19.19% 22.45 10 41 2790.11 2790 2790 2790.11 2790 2790 62633 62633 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15944.68 22775.38 29.99% 270.69 270.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 33.02 25 40 325.55 326 326 325.55 326 326 10751 15356 29.99%
crit 19.46% 7.98 1 16 651.10 651 651 651.10 651 651 5194 7419 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1651 1134 Direct 91.9 1395 2790 1664 19.3%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152887.33 152887.33 0.00% 1134.25 1134.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 74.16 56 97 1395.06 1395 1395 1395.06 1395 1395 103451 103451 0.00%
crit 19.29% 17.72 8 30 2790.11 2790 2790 2790.11 2790 2790 49436 49436 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Venthyr_DuplicitousHavoc
Havoc 9.5 32.16sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.54 0.00 0.00 0.00 1.2436 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.55
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.4sec 54.10% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 24.5s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • backdraft_1:54.10%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.6s
  • trigger_min/max:180.0s / 182.6s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.53% 8.51% 14.00% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_DuplicitousHavoc
soul_fire Soul Shard 6.53 7.16 7.72% 1.10 0.43 5.60%
immolate Soul Shard 343.33 33.07 35.64% 0.10 1.27 3.69%
incinerate Soul Shard 41.37 10.46 11.27% 0.25 0.00 0.02%
conflagrate Soul Shard 36.78 27.64 29.79% 0.75 0.00 0.00%
mana_regen Mana 651.05 121103.83 100.00% 186.01 27429.58 18.47%
immolate_crits Soul Shard 33.19 3.20 3.44% 0.10 0.12 3.71%
incinerate_crits Soul Shard 10.11 1.01 1.09% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.25 11.04% 0.09 1.75 14.61%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.84 410.30 27445.8 48969.8 46648.0 50000.0
Soul Shard 4.0 0.31 0.31 3.6 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_DuplicitousHavoc
cataclysm Mana 9.6 4803.6 500.0 500.5 48.0
channel_demonfire Mana 12.2 9127.8 750.0 749.9 33.6
chaos_bolt Soul Shard 22.5 44.9 2.0 2.0 12388.8
conflagrate Mana 36.8 18390.4 500.0 499.9 13.7
havoc Mana 9.5 9547.3 1000.0 1001.1 0.0
immolate Mana 28.0 21027.2 750.0 750.0 22.9
impending_catastrophe Mana 4.7 9347.0 2000.0 2003.6 7.2
incinerate Mana 41.4 41367.5 1000.0 1000.4 4.0
rain_of_fire Soul Shard 16.2 48.7 3.0 3.0 5198.9
soul_fire Mana 6.5 6533.1 1000.0 1182.6 23.6
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.3

Statistics & Data Analysis

Fight Length
Venthyr_DuplicitousHavoc Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Venthyr_DuplicitousHavoc Damage Per Second
Count 618
Mean 9616.36
Minimum 9152.94
Maximum 10207.14
Spread ( max - min ) 1054.20
Range [ ( max - min ) / 2 * 100% ] 5.48%
Standard Deviation 207.0394
5th Percentile 9302.86
95th Percentile 9943.03
( 95th Percentile - 5th Percentile ) 640.17
Mean Distribution
Standard Deviation 8.3283
95.00% Confidence Interval ( 9600.04 - 9632.68 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1781
0.1 Scale Factor Error with Delta=300 366
0.05 Scale Factor Error with Delta=300 1464
0.01 Scale Factor Error with Delta=300 36593
Priority Target DPS
Venthyr_DuplicitousHavoc Priority Target Damage Per Second
Count 618
Mean 5007.83
Minimum 4732.76
Maximum 5403.14
Spread ( max - min ) 670.38
Range [ ( max - min ) / 2 * 100% ] 6.69%
Standard Deviation 122.2541
5th Percentile 4820.65
95th Percentile 5205.29
( 95th Percentile - 5th Percentile ) 384.64
Mean Distribution
Standard Deviation 4.9178
95.00% Confidence Interval ( 4998.19 - 5017.47 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2290
0.1 Scale Factor Error with Delta=300 128
0.05 Scale Factor Error with Delta=300 511
0.01 Scale Factor Error with Delta=300 12759
DPS(e)
Venthyr_DuplicitousHavoc Damage Per Second (Effective)
Count 618
Mean 9616.36
Minimum 9152.94
Maximum 10207.14
Spread ( max - min ) 1054.20
Range [ ( max - min ) / 2 * 100% ] 5.48%
Damage
Venthyr_DuplicitousHavoc Damage
Count 618
Mean 2492324.69
Minimum 2008903.05
Maximum 3020633.26
Spread ( max - min ) 1011730.21
Range [ ( max - min ) / 2 * 100% ] 20.30%
DTPS
Venthyr_DuplicitousHavoc Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_DuplicitousHavoc Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_DuplicitousHavoc Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_DuplicitousHavoc Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_DuplicitousHavoc Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_DuplicitousHavoc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_DuplicitousHavocTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_DuplicitousHavoc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.55 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.67 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.14 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.17 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.94 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.55 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.09 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.30 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.70 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.62 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.48 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.07 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.18 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.58 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.99 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFDKLJLJDLALJEHQQRNOFFFIJLEIJLALLHNQQPRNEIFLJKLLL9AHQNQNQPNEILLFFFJLLIJAHRQRNQP9EJFIKLJFLLAHNQQRNPEILJLFMLLDJ9AEHQNQNPQDLJFKEFFLIJAHRNQRQP9EJFILJLFLJIAHRRNQRQPEFJFKLJILL9AHNQQRNPEILJL

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:04.144 cds M summon_infernal Fluffy_Pillow 49822.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust
0:05.150 aoe H havoc enemy2 49325.0/50000: 99% mana
4.5/5: 90% soul_shard
bloodlust
0:06.157 havoc Q chaos_bolt Fluffy_Pillow 48828.5/50000: 98% mana
5.0/5: 100% soul_shard
bloodlust
0:08.166 havoc N conflagrate Fluffy_Pillow 49833.0/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:09.173 havoc Q chaos_bolt Fluffy_Pillow 49836.5/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.578 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.585 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.591 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.998 havoc N conflagrate Fluffy_Pillow 49955.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:15.004 havoc Q chaos_bolt Fluffy_Pillow 49958.5/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.409 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.416 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.1/5: 82% soul_shard
bloodlust, backdraft
0:18.422 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:20.649 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:21.654 aoe F immolate enemy2 49251.5/50000: 99% mana
2.6/5: 52% soul_shard
bloodlust, backdraft
0:22.660 aoe F immolate enemy3 49004.5/50000: 98% mana
2.9/5: 58% soul_shard
bloodlust, backdraft
0:23.667 aoe D rain_of_fire Fluffy_Pillow 48758.0/50000: 98% mana
3.1/5: 62% soul_shard
bloodlust, backdraft
0:24.674 aoe K impending_catastrophe Fluffy_Pillow 49261.5/50000: 99% mana
0.5/5: 10% soul_shard
bloodlust, backdraft
0:26.015 aoe L incinerate Fluffy_Pillow 47932.0/50000: 96% mana
0.9/5: 18% soul_shard
bloodlust, backdraft
0:26.957 aoe J conflagrate Fluffy_Pillow 47403.0/50000: 95% mana
1.4/5: 28% soul_shard
bloodlust
0:27.963 aoe L incinerate Fluffy_Pillow 47406.0/50000: 95% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:28.902 aoe J conflagrate Fluffy_Pillow 46875.5/50000: 94% mana
2.8/5: 56% soul_shard
bloodlust
0:29.910 aoe D rain_of_fire Fluffy_Pillow 46879.5/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:30.917 aoe L incinerate Fluffy_Pillow 47383.0/50000: 95% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:31.857 default A cataclysm Fluffy_Pillow 46853.0/50000: 94% mana
1.6/5: 32% soul_shard
bloodlust
0:33.197 aoe L incinerate Fluffy_Pillow 47023.0/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust
0:34.537 aoe J conflagrate Fluffy_Pillow 46693.0/50000: 93% mana
2.7/5: 54% soul_shard
bloodlust
0:35.786 aoe E channel_demonfire Fluffy_Pillow 46817.5/50000: 94% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:38.147 aoe H havoc enemy2 47248.0/50000: 94% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:39.152 havoc Q chaos_bolt Fluffy_Pillow 46750.5/50000: 94% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:40.559 havoc Q chaos_bolt Fluffy_Pillow 47454.0/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust
0:42.569 havoc R incinerate Fluffy_Pillow 48459.0/50000: 97% mana
0.6/5: 12% soul_shard
0:44.308 havoc N conflagrate Fluffy_Pillow 48328.5/50000: 97% mana
1.2/5: 24% soul_shard
0:45.614 havoc O soul_fire Fluffy_Pillow 48481.5/50000: 97% mana
2.4/5: 48% soul_shard
backdraft
0:49.091 aoe F immolate enemy2 49002.0/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
0:50.397 aoe F immolate Fluffy_Pillow 48905.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:51.703 aoe F immolate enemy3 48808.0/50000: 98% mana
4.8/5: 96% soul_shard
backdraft
0:53.011 aoe I rain_of_fire Fluffy_Pillow 48712.0/50000: 97% mana
5.0/5: 100% soul_shard
backdraft
0:54.317 aoe J conflagrate Fluffy_Pillow 49365.0/50000: 99% mana
2.1/5: 42% soul_shard
0:55.624 aoe L incinerate Fluffy_Pillow 49518.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
0:56.845 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
3.2/5: 64% soul_shard
0:59.690 aoe I rain_of_fire Fluffy_Pillow 49675.5/50000: 99% mana
3.5/5: 70% soul_shard
1:00.995 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
1:02.303 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
backdraft
1:03.522 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
1.8/5: 36% soul_shard
1:05.263 aoe L incinerate Fluffy_Pillow 49372.5/50000: 99% mana
2.0/5: 40% soul_shard
1:07.004 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
1:08.744 aoe H havoc enemy2 48872.5/50000: 98% mana
2.9/5: 58% soul_shard
1:10.050 havoc N conflagrate Fluffy_Pillow 48525.5/50000: 97% mana
3.0/5: 60% soul_shard
1:11.356 havoc Q chaos_bolt Fluffy_Pillow 48678.5/50000: 97% mana
4.3/5: 86% soul_shard
backdraft
1:13.185 havoc Q chaos_bolt Fluffy_Pillow 49593.0/50000: 99% mana
2.5/5: 50% soul_shard
1:15.795 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:17.101 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.0/5: 20% soul_shard
1:18.843 havoc N conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.6/5: 32% soul_shard
1:20.150 aoe E channel_demonfire Fluffy_Pillow 49156.5/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:22.978 aoe I rain_of_fire Fluffy_Pillow 49820.5/50000: 100% mana
3.1/5: 62% soul_shard
backdraft
1:24.285 aoe F immolate enemy3 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
1:25.591 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.4/5: 8% soul_shard
backdraft
1:26.810 aoe J conflagrate Fluffy_Pillow 48861.5/50000: 98% mana
0.7/5: 14% soul_shard
1:28.117 aoe K impending_catastrophe Fluffy_Pillow 49015.0/50000: 98% mana
1.4/5: 28% soul_shard
backdraft
1:29.857 aoe L incinerate Fluffy_Pillow 47885.0/50000: 96% mana
1.8/5: 36% soul_shard
backdraft
1:31.075 aoe L incinerate Fluffy_Pillow 47494.0/50000: 95% mana
2.0/5: 40% soul_shard
1:32.815 aoe L incinerate Fluffy_Pillow 47364.0/50000: 95% mana
2.5/5: 50% soul_shard
1:34.557 default 9 soul_fire Fluffy_Pillow 47235.0/50000: 94% mana
2.8/5: 56% soul_shard
1:38.036 default A cataclysm Fluffy_Pillow 47974.5/50000: 96% mana
4.4/5: 88% soul_shard
1:39.775 aoe H havoc enemy2 48344.0/50000: 97% mana
4.5/5: 90% soul_shard
1:41.083 havoc Q chaos_bolt Fluffy_Pillow 47998.0/50000: 96% mana
4.5/5: 90% soul_shard
1:43.693 havoc N conflagrate Fluffy_Pillow 49303.0/50000: 99% mana
2.8/5: 56% soul_shard
1:45.000 havoc Q chaos_bolt Fluffy_Pillow 49456.5/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
1:46.829 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
1:48.134 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.5/5: 70% soul_shard
backdraft
1:49.962 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.6/5: 32% soul_shard
1:51.268 havoc N conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.7/5: 34% soul_shard
1:52.574 aoe E channel_demonfire Fluffy_Pillow 49405.0/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
1:55.327 aoe I rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
1:56.633 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
backdraft
1:57.853 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
1:59.594 aoe F immolate enemy3 48873.0/50000: 98% mana
1.2/5: 24% soul_shard
2:00.901 aoe F immolate enemy2 48776.5/50000: 98% mana
1.5/5: 30% soul_shard
2:02.207 aoe F immolate Fluffy_Pillow 48679.5/50000: 97% mana
1.6/5: 32% soul_shard
2:03.512 aoe J conflagrate Fluffy_Pillow 48582.0/50000: 97% mana
1.8/5: 36% soul_shard
2:04.819 aoe L incinerate Fluffy_Pillow 48735.5/50000: 97% mana
2.5/5: 50% soul_shard
backdraft
2:06.038 aoe L incinerate Fluffy_Pillow 48345.0/50000: 97% mana
2.9/5: 58% soul_shard
2:07.778 aoe I rain_of_fire Fluffy_Pillow 48215.0/50000: 96% mana
3.3/5: 66% soul_shard
2:09.084 aoe J conflagrate Fluffy_Pillow 48868.0/50000: 98% mana
0.4/5: 8% soul_shard
2:10.391 default A cataclysm Fluffy_Pillow 49021.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
2:12.131 aoe H havoc enemy2 49391.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
2:13.437 havoc R incinerate Fluffy_Pillow 49044.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:14.658 havoc Q chaos_bolt Fluffy_Pillow 48655.0/50000: 97% mana
2.1/5: 42% soul_shard
2:17.267 havoc R incinerate Fluffy_Pillow 49959.5/50000: 100% mana
0.5/5: 10% soul_shard
2:19.007 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:20.314 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:22.142 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:23.448 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
2:26.925 aoe E channel_demonfire Fluffy_Pillow 49002.0/50000: 98% mana
2.1/5: 42% soul_shard
2:29.695 aoe J conflagrate Fluffy_Pillow 49637.0/50000: 99% mana
2.4/5: 48% soul_shard
2:31.002 aoe F immolate enemy3 49790.5/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
2:32.310 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
2:33.617 aoe K impending_catastrophe Fluffy_Pillow 49906.5/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
2:35.357 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
0.6/5: 12% soul_shard
backdraft
2:36.578 aoe J conflagrate Fluffy_Pillow 47612.5/50000: 95% mana
1.0/5: 20% soul_shard
2:37.885 aoe F immolate enemy2 47766.0/50000: 96% mana
1.6/5: 32% soul_shard
backdraft
2:39.192 aoe L incinerate Fluffy_Pillow 47669.5/50000: 95% mana
1.8/5: 36% soul_shard
backdraft
2:40.412 aoe L incinerate Fluffy_Pillow 47279.5/50000: 95% mana
2.1/5: 42% soul_shard
2:42.153 default A cataclysm Fluffy_Pillow 47150.0/50000: 94% mana
2.6/5: 52% soul_shard
2:43.892 aoe H havoc enemy2 47519.5/50000: 95% mana
2.8/5: 56% soul_shard
2:45.200 havoc N conflagrate Fluffy_Pillow 47173.5/50000: 94% mana
3.0/5: 60% soul_shard
2:46.506 havoc Q chaos_bolt Fluffy_Pillow 47326.5/50000: 95% mana
4.1/5: 82% soul_shard
backdraft
2:48.333 havoc Q chaos_bolt Fluffy_Pillow 48240.0/50000: 96% mana
2.3/5: 46% soul_shard
2:50.941 havoc R incinerate Fluffy_Pillow 49544.0/50000: 99% mana
0.6/5: 12% soul_shard
2:52.682 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:53.989 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:55.296 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
2:58.116 aoe I rain_of_fire Fluffy_Pillow 49719.5/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
2:59.422 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.1/5: 2% soul_shard
backdraft
3:00.641 aoe J conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
0.5/5: 10% soul_shard
3:01.949 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
3:03.167 aoe F immolate enemy3 48765.0/50000: 98% mana
1.5/5: 30% soul_shard
3:04.474 cds M summon_infernal Fluffy_Pillow 48668.5/50000: 97% mana
1.6/5: 32% soul_shard
3:05.780 aoe L incinerate Fluffy_Pillow 48321.5/50000: 97% mana
2.0/5: 40% soul_shard
3:07.522 aoe L incinerate Fluffy_Pillow 48192.5/50000: 96% mana
2.7/5: 54% soul_shard
3:09.263 aoe D rain_of_fire Fluffy_Pillow 48063.0/50000: 96% mana
3.4/5: 68% soul_shard
3:10.569 aoe J conflagrate Fluffy_Pillow 48716.0/50000: 97% mana
0.9/5: 18% soul_shard
3:11.873 default 9 soul_fire Fluffy_Pillow 48868.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
3:15.397 default A cataclysm Fluffy_Pillow 49001.5/50000: 98% mana
4.1/5: 82% soul_shard
backdraft
3:17.138 aoe E channel_demonfire Fluffy_Pillow 49372.0/50000: 99% mana
4.5/5: 90% soul_shard
backdraft
3:19.977 aoe H havoc enemy2 50000.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
3:21.283 havoc Q chaos_bolt Fluffy_Pillow 49653.0/50000: 99% mana
5.0/5: 100% soul_shard
3:23.893 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.199 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:27.027 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:28.334 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:29.640 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.9/5: 98% soul_shard
backdraft
3:31.468 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:32.776 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
3:34.517 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
3:35.848 aoe F immolate enemy3 49168.0/50000: 98% mana
1.9/5: 38% soul_shard
backdraft
3:37.153 aoe K impending_catastrophe Fluffy_Pillow 49070.5/50000: 98% mana
2.0/5: 40% soul_shard
backdraft
3:38.894 aoe E channel_demonfire Fluffy_Pillow 47941.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft
3:41.739 aoe F immolate Fluffy_Pillow 48613.5/50000: 97% mana
2.6/5: 52% soul_shard
backdraft
3:43.045 aoe F immolate enemy2 48516.5/50000: 97% mana
2.7/5: 54% soul_shard
backdraft
3:44.351 aoe L incinerate Fluffy_Pillow 48419.5/50000: 97% mana
2.9/5: 58% soul_shard
backdraft
3:45.571 aoe I rain_of_fire Fluffy_Pillow 48029.5/50000: 96% mana
3.1/5: 62% soul_shard
3:46.878 aoe J conflagrate Fluffy_Pillow 48683.0/50000: 97% mana
0.3/5: 6% soul_shard
3:48.184 default A cataclysm Fluffy_Pillow 48836.0/50000: 98% mana
0.9/5: 18% soul_shard
backdraft
3:49.925 aoe H havoc enemy2 49206.5/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
3:51.283 havoc R incinerate Fluffy_Pillow 48885.5/50000: 98% mana
1.3/5: 26% soul_shard
backdraft
3:52.504 havoc N conflagrate Fluffy_Pillow 48496.0/50000: 97% mana
1.9/5: 38% soul_shard
3:53.810 havoc Q chaos_bolt Fluffy_Pillow 48649.0/50000: 97% mana
3.0/5: 60% soul_shard
backdraft
3:55.638 havoc R incinerate Fluffy_Pillow 49563.0/50000: 99% mana
1.4/5: 28% soul_shard
3:57.380 havoc Q chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
3:59.988 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:01.294 default 9 soul_fire Fluffy_Pillow 49252.0/50000: 99% mana
0.7/5: 14% soul_shard
4:04.772 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
4:07.475 aoe J conflagrate Fluffy_Pillow 49604.0/50000: 99% mana
2.5/5: 50% soul_shard
4:08.782 aoe F immolate enemy3 49757.5/50000: 100% mana
3.2/5: 64% soul_shard
backdraft
4:10.088 aoe I rain_of_fire Fluffy_Pillow 49252.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
4:11.396 aoe L incinerate Fluffy_Pillow 49906.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
4:12.617 aoe J conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
0.9/5: 18% soul_shard
4:13.925 aoe L incinerate Fluffy_Pillow 49157.0/50000: 98% mana
1.7/5: 34% soul_shard
backdraft
4:15.144 aoe F immolate enemy2 48766.5/50000: 98% mana
2.1/5: 42% soul_shard
4:16.449 aoe L incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.4/5: 48% soul_shard
4:18.189 aoe J conflagrate Fluffy_Pillow 48539.0/50000: 97% mana
2.9/5: 58% soul_shard
4:19.495 aoe I rain_of_fire Fluffy_Pillow 48692.0/50000: 97% mana
3.5/5: 70% soul_shard
backdraft
4:20.800 default A cataclysm Fluffy_Pillow 49344.5/50000: 99% mana
0.7/5: 14% soul_shard
backdraft
4:22.541 aoe H havoc enemy2 49502.5/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:23.848 havoc R incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.2/5: 24% soul_shard
backdraft
4:25.068 havoc R incinerate Fluffy_Pillow 48766.0/50000: 98% mana
1.7/5: 34% soul_shard
4:26.807 havoc N conflagrate Fluffy_Pillow 48635.5/50000: 97% mana
2.4/5: 48% soul_shard
4:28.114 havoc Q chaos_bolt Fluffy_Pillow 48789.0/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:29.941 havoc R incinerate Fluffy_Pillow 49702.5/50000: 99% mana
1.7/5: 34% soul_shard
4:31.682 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.4/5: 48% soul_shard
4:34.294 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
4:35.601 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
4:38.342 aoe F immolate enemy2 49873.0/50000: 100% mana
1.0/5: 20% soul_shard
4:39.648 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
1.1/5: 22% soul_shard
4:40.953 aoe F immolate enemy3 49404.5/50000: 99% mana
1.7/5: 34% soul_shard
backdraft
4:42.260 aoe K impending_catastrophe Fluffy_Pillow 49252.5/50000: 99% mana
1.9/5: 38% soul_shard
backdraft
4:44.000 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
2.1/5: 42% soul_shard
backdraft
4:45.219 aoe J conflagrate Fluffy_Pillow 47611.5/50000: 95% mana
2.4/5: 48% soul_shard
4:46.525 aoe I rain_of_fire Fluffy_Pillow 47764.5/50000: 96% mana
3.0/5: 60% soul_shard
backdraft
4:47.831 aoe L incinerate Fluffy_Pillow 48417.5/50000: 97% mana
0.2/5: 4% soul_shard
backdraft
4:49.051 aoe L incinerate Fluffy_Pillow 48027.5/50000: 96% mana
0.5/5: 10% soul_shard
4:50.791 default 9 soul_fire Fluffy_Pillow 47897.5/50000: 96% mana
1.0/5: 20% soul_shard
4:54.268 default A cataclysm Fluffy_Pillow 48636.0/50000: 97% mana
2.7/5: 54% soul_shard
4:56.010 aoe H havoc enemy2 49007.0/50000: 98% mana
2.9/5: 58% soul_shard
4:57.318 havoc N conflagrate Fluffy_Pillow 48661.0/50000: 97% mana
3.0/5: 60% soul_shard
4:58.624 havoc Q chaos_bolt Fluffy_Pillow 48814.0/50000: 98% mana
4.3/5: 86% soul_shard
backdraft
5:00.450 havoc Q chaos_bolt Fluffy_Pillow 49727.0/50000: 99% mana
2.4/5: 48% soul_shard
5:03.060 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
5:04.800 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
5:06.108 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
5:07.413 aoe E channel_demonfire Fluffy_Pillow 49058.5/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
5:10.215 aoe I rain_of_fire Fluffy_Pillow 49709.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
5:11.520 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
backdraft
5:12.740 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
0.8/5: 16% soul_shard
5:14.047 aoe L incinerate Fluffy_Pillow 49156.0/50000: 98% mana
1.3/5: 26% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_DuplicitousHavoc"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=208:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Venthyr_InfernalBrand : 9470 dps, 5067 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9469.6 9469.6 17.0 / 0.180% 837.3 / 8.8% 19.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
410.4 407.0 Mana 0.00% 38.1 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_InfernalBrand 9470
Cataclysm 775 8.2% 9.6 32.49sec 24008 14133 Direct 28.8 6699 13397 8002 19.5%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.59 28.78 0.00 0.00 1.6988 0.0000 230333.13 230333.13 0.00% 14132.60 14132.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.53% 23.18 14 32 6699.08 6141 7260 6698.75 6525 6898 155248 155248 0.00%
crit 19.47% 5.61 1 15 13397.27 12283 14521 13400.01 12381 14427 75085 75085 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.67
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1030) 0.0% (10.9%) 12.1 25.45sec 25205 9357

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.14 0.00 181.50 0.00 2.6938 0.1634 0.00 0.00 0.00% 9356.99 9356.99

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.15
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1030 10.9% 0.0 0.00sec 0 0 Direct 544.5 471 942 562 19.3%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 544.51 0.00 0.00 0.0000 0.0000 306095.26 306095.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 439.35 323 570 471.29 263 976 471.52 449 500 207040 207040 0.00%
crit 19.31% 105.16 68 149 942.06 525 1952 942.50 811 1141 99055 99055 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1282 (1749) 13.5% (18.5%) 22.4 13.02sec 23158 11764 Direct 44.6 (88.8) 0 8529 8529 100.0% (59.8%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.41 44.60 0.00 0.00 1.9685 0.0000 380343.13 380343.13 0.00% 11764.50 11764.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 44.60 32 58 8528.52 5861 11548 8529.01 8319 8761 380343 380343 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [Q]:22.52
  • if_expr:cast_time<havoc_remains
    Internal Combustion 468 4.9% 44.3 12.99sec 3134 0 Direct 44.3 2627 5265 3133 19.2%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.26 44.25 0.00 0.00 0.0000 0.0000 138683.08 138683.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 35.75 22 51 2626.76 1 3715 2627.79 2452 2788 93904 93904 0.00%
crit 19.22% 8.50 2 18 5265.08 71 7430 5271.59 3989 6313 44779 44779 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 802 8.5% 36.8 7.94sec 6479 5186 Direct 55.3 3615 7246 4312 19.2%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.78 55.27 0.00 0.00 1.2494 0.0000 238271.96 238271.96 0.00% 5185.69 5185.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 44.68 31 59 3615.19 2047 5042 3615.43 3409 3840 161512 161512 0.00%
crit 19.17% 10.59 3 23 7246.46 4096 10084 7243.77 5256 9154 76760 76760 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:18.30
  • if_expr:buff.backdraft.down
    havoc
    [N]:18.47
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1608 17.0% 27.9 10.46sec 17156 13579 Direct 34.8 1538 3076 1841 19.7%
Periodic 343.1 1012 2028 1207 19.2% 95.4%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.88 34.78 343.13 343.13 1.2635 2.4812 478364.43 478364.43 0.00% 539.54 13578.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.34% 27.94 16 39 1537.66 819 2017 1538.13 1444 1643 42954 42954 0.00%
crit 19.66% 6.84 1 14 3075.82 1639 4033 3078.45 2207 3789 21035 21035 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.79% 277.22 211 350 1012.48 1 1261 1012.62 996 1032 280689 280689 0.00%
crit 19.21% 65.91 33 96 2027.96 1 2521 2028.18 1885 2143 133687 133687 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.81
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [P]:8.15
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Impending Catastrophe 0 (228) 0.0% (2.4%) 4.7 64.52sec 14508 8768

Stats Details: Impending Catastrophe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 1.6547 0.0000 0.00 0.00 0.00% 8768.18 8768.18

Action Details: Impending Catastrophe

  • id:321792
  • school:shadow
  • range:40.0
  • travel_speed:16.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:321792
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.

Action Priority List

    aoe
    [K]:4.70
  • if_expr:!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
    Impending Catastrophe (_impact) 31 0.3% 0.0 0.00sec 0 0 Direct 13.9 558 1116 668 19.7%

Stats Details: Impending Catastrophe Impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 13.86 0.00 0.00 0.0000 0.0000 9257.03 9257.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.30% 11.13 6 18 558.02 558 558 558.02 558 558 6210 6210 0.00%
crit 19.70% 2.73 0 8 1116.04 1116 1116 1056.45 0 1116 3047 3047 0.00%

Action Details: Impending Catastrophe Impact

  • id:322167
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:322167
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
    Impending Catastrophe (_dot) 197 2.1% 0.0 0.00sec 0 0 Periodic 101.1 484 967 577 19.4% 18.3%

Stats Details: Impending Catastrophe Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 101.08 101.08 0.0000 1.6128 58354.41 58354.41 0.00% 357.95 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.63% 81.50 57 106 483.61 446 488 483.62 482 486 39414 39414 0.00%
crit 19.37% 19.58 9 33 967.18 891 977 967.12 950 977 18940 18940 0.00%

Action Details: Impending Catastrophe Dot

  • id:322170
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.175000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322170
  • name:Impending Catastrophe
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc321792=Call forth a cloud of chaotic anima that travels to the target enemy, dealing {$322167s1=0} Shadow damage to enemies in its path. When the anima reaches the target it explodes, inflicting either Curse of Weakness or Curse of Tongues, and dealing $322170o1 Shadow damage over {$322170d=12 seconds} to all nearby enemies.}
Incinerate 543 5.8% 41.5 6.46sec 3898 2667 Direct 52.1 (52.1) 2614 5196 3109 19.2% (19.2%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.53 52.07 0.00 0.00 1.4620 0.0000 161906.41 161906.41 0.00% 2666.57 2666.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 42.06 24 64 2613.61 1312 3232 2615.28 2417 2858 109920 109920 0.00%
crit 19.22% 10.01 2 22 5196.09 2625 6463 5203.00 3914 6245 51987 51987 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [L]:30.85
    havoc
    [R]:10.93
  • if_expr:cast_time<havoc_remains
Rain of Fire 854 9.0% 16.3 17.30sec 15619 12511 Periodic 385.3 553 1105 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.25 0.00 0.00 385.29 1.2485 0.0000 253854.46 253854.46 0.00% 12511.31 12511.31
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 311.37 209 423 552.91 507 599 552.94 546 560 172157 172157 0.00%
crit 19.19% 73.92 42 120 1105.20 1013 1198 1105.21 1082 1126 81697 81697 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.16
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.10
Soul Fire 504 5.3% 5.5 49.44sec 27154 7809 Direct 7.5 16707 33365 19857 19.0%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.52 7.54 0.00 0.00 3.4775 0.0000 149872.95 149872.95 0.00% 7808.73 7808.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.00% 6.11 2 10 16706.87 8602 21176 16742.96 13249 19822 102092 102092 0.00%
crit 19.00% 1.43 0 5 33365.00 17605 42352 26915.87 0 42352 47781 47781 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.55
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:1.08
  • if_expr:cast_time<havoc_remains
Summon Infernal 81 0.8% 2.0 180.50sec 11935 10325 Direct 6.0 3348 6696 3980 18.8%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23870.36 23870.36 0.00% 10324.55 10324.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.18% 4.87 2 6 3348.13 3348 3348 3348.13 3348 3348 16307 16307 0.00%
crit 18.82% 1.13 0 4 6696.27 6696 6696 4767.57 0 6696 7563 7563 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [M]:2.00
pet - infernal 3829 / 782
Immolation 3563 7.6% 39.0 5.49sec 5482 0 Direct 117.0 1528 3066 1827 19.4%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 213787.54 213787.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 94.26 81 108 1528.23 1395 2023 1528.17 1491 1564 144044 144044 0.00%
crit 19.44% 22.74 9 36 3066.40 2790 4046 3066.95 2835 3355 69743 69743 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.5%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15955.74 22791.19 29.99% 270.88 270.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.46% 32.99 25 41 325.55 326 326 325.55 326 326 10740 15340 29.99%
crit 19.54% 8.01 0 16 651.10 651 651 650.05 0 651 5216 7451 29.94%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.4% 92.6 3.21sec 1650 1133 Direct 91.9 1395 2790 1663 19.2%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152760.92 152760.92 0.00% 1133.32 1133.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 74.25 53 96 1395.06 1395 1395 1395.06 1395 1395 103577 103577 0.00%
crit 19.19% 17.63 7 32 2790.11 2790 2790 2790.11 2790 2790 49184 49184 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
Venthyr_InfernalBrand
Havoc 9.5 32.26sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.55 0.00 0.00 0.00 1.2436 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.56
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.4sec 54.15% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:Venthyr_InfernalBrand
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 23.4s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:54.15%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_InfernalBrand
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:Venthyr_InfernalBrand_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.8s
  • trigger_min/max:180.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:Venthyr_InfernalBrand_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.8s
  • trigger_min/max:180.0s / 182.8s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 11.52% 8.40% 14.30% 0.8s 0.0s 5.7s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_InfernalBrand
soul_fire Soul Shard 6.53 7.18 7.73% 1.10 0.41 5.40%
immolate Soul Shard 343.19 33.09 35.65% 0.10 1.23 3.59%
incinerate Soul Shard 41.57 10.48 11.29% 0.25 0.00 0.04%
conflagrate Soul Shard 36.77 27.63 29.77% 0.75 0.00 0.00%
mana_regen Mana 651.39 121149.59 100.00% 185.99 27379.88 18.43%
immolate_crits Soul Shard 32.96 3.18 3.43% 0.10 0.11 3.45%
incinerate_crits Soul Shard 10.00 1.00 1.08% 0.10 0.00 0.02%
infernal Soul Shard 120.00 10.26 11.05% 0.09 1.74 14.53%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 406.95 410.41 27402.5 48972.3 47015.0 50000.0
Soul Shard 4.0 0.31 0.31 3.5 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
Venthyr_InfernalBrand
cataclysm Mana 9.6 4802.1 500.0 500.5 48.0
channel_demonfire Mana 12.1 9110.0 750.0 750.2 33.6
chaos_bolt Soul Shard 22.4 44.8 2.0 2.0 11591.6
conflagrate Mana 36.8 18384.9 500.0 499.9 13.0
havoc Mana 9.6 9558.4 1000.0 1001.2 0.0
immolate Mana 27.9 20899.4 750.0 749.5 22.9
impending_catastrophe Mana 4.7 9337.5 2000.0 2003.7 7.2
incinerate Mana 41.6 41567.8 1000.0 1000.9 3.9
rain_of_fire Soul Shard 16.3 48.8 3.0 3.0 5203.0
soul_fire Mana 6.5 6526.8 1000.0 1182.5 23.0
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 11.9
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
Venthyr_InfernalBrand Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Venthyr_InfernalBrand Damage Per Second
Count 618
Mean 9469.59
Minimum 8935.05
Maximum 10057.42
Spread ( max - min ) 1122.37
Range [ ( max - min ) / 2 * 100% ] 5.93%
Standard Deviation 216.2254
5th Percentile 9130.21
95th Percentile 9853.95
( 95th Percentile - 5th Percentile ) 723.74
Mean Distribution
Standard Deviation 8.6979
95.00% Confidence Interval ( 9452.54 - 9486.64 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2003
0.1 Scale Factor Error with Delta=300 400
0.05 Scale Factor Error with Delta=300 1597
0.01 Scale Factor Error with Delta=300 39912
Priority Target DPS
Venthyr_InfernalBrand Priority Target Damage Per Second
Count 618
Mean 5067.38
Minimum 4711.45
Maximum 5484.76
Spread ( max - min ) 773.32
Range [ ( max - min ) / 2 * 100% ] 7.63%
Standard Deviation 127.5382
5th Percentile 4868.18
95th Percentile 5281.21
( 95th Percentile - 5th Percentile ) 413.03
Mean Distribution
Standard Deviation 5.1303
95.00% Confidence Interval ( 5057.32 - 5077.43 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2434
0.1 Scale Factor Error with Delta=300 139
0.05 Scale Factor Error with Delta=300 556
0.01 Scale Factor Error with Delta=300 13886
DPS(e)
Venthyr_InfernalBrand Damage Per Second (Effective)
Count 618
Mean 9469.59
Minimum 8935.05
Maximum 10057.42
Spread ( max - min ) 1122.37
Range [ ( max - min ) / 2 * 100% ] 5.93%
Damage
Venthyr_InfernalBrand Damage
Count 618
Mean 2429206.62
Minimum 1955954.38
Maximum 2948486.17
Spread ( max - min ) 992531.79
Range [ ( max - min ) / 2 * 100% ] 20.43%
DTPS
Venthyr_InfernalBrand Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_InfernalBrand Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_InfernalBrand Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_InfernalBrand Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_InfernalBrand Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_InfernalBrand Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_InfernalBrandTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_InfernalBrand Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.55 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.67 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.16 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.15 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.81 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.56 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.10 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 18.30 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 4.70 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
L 30.85 incinerate
actions.cds
# count action,conditions
M 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
N 18.47 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
O 1.08 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
P 8.15 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Q 22.52 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
R 10.93 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AEMHQNQNPQNQNDEFFFKDLJLJDLALJEHQQRPNQ9FJFEILJLALJHQRQPRNELFIJKLLJLA9HQNQQPEJFLLJILLLAJHQRQPRNEL9FFFIJKIAHRNQRNQNPEFLFIJMLLDJLAHOQNQDEJFFDFLJLKLLAHNQQNQPEJLL9FFFIJLAHNQQRNPEILLFJLLKIJLLAE9HQNQNQPLFJE

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.741 aoe E channel_demonfire Fluffy_Pillow 49370.5/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.928 cds M summon_infernal Fluffy_Pillow 49714.0/50000: 99% mana
4.3/5: 86% soul_shard
bloodlust
0:04.934 aoe H havoc enemy2 49217.0/50000: 98% mana
4.5/5: 90% soul_shard
bloodlust
0:05.940 havoc Q chaos_bolt Fluffy_Pillow 48720.0/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.949 havoc N conflagrate Fluffy_Pillow 49724.5/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.955 havoc Q chaos_bolt Fluffy_Pillow 49727.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.363 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.368 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.374 havoc Q chaos_bolt Fluffy_Pillow 49252.0/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.780 havoc N conflagrate Fluffy_Pillow 49955.0/50000: 100% mana
2.9/5: 58% soul_shard
bloodlust
0:14.786 havoc Q chaos_bolt Fluffy_Pillow 49958.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:16.192 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:17.200 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.0/5: 80% soul_shard
bloodlust, backdraft
0:18.208 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
bloodlust, backdraft
0:20.666 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
bloodlust, backdraft
0:21.673 aoe F immolate enemy2 49252.5/50000: 99% mana
2.5/5: 50% soul_shard
bloodlust, backdraft
0:22.679 aoe F immolate enemy3 49005.5/50000: 98% mana
2.8/5: 56% soul_shard
bloodlust, backdraft
0:23.686 aoe K impending_catastrophe Fluffy_Pillow 48759.0/50000: 98% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:25.026 aoe D rain_of_fire Fluffy_Pillow 47429.0/50000: 95% mana
3.5/5: 70% soul_shard
bloodlust, backdraft
0:26.031 aoe L incinerate Fluffy_Pillow 47931.5/50000: 96% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:26.970 aoe J conflagrate Fluffy_Pillow 47401.0/50000: 95% mana
1.5/5: 30% soul_shard
bloodlust
0:27.976 aoe L incinerate Fluffy_Pillow 47404.0/50000: 95% mana
2.4/5: 48% soul_shard
bloodlust, backdraft
0:28.914 aoe J conflagrate Fluffy_Pillow 46873.0/50000: 94% mana
2.8/5: 56% soul_shard
bloodlust
0:29.920 aoe D rain_of_fire Fluffy_Pillow 46876.0/50000: 94% mana
3.7/5: 74% soul_shard
bloodlust, backdraft
0:30.925 aoe L incinerate Fluffy_Pillow 47378.5/50000: 95% mana
1.0/5: 20% soul_shard
bloodlust, backdraft
0:31.864 default A cataclysm Fluffy_Pillow 46848.0/50000: 94% mana
1.6/5: 32% soul_shard
bloodlust
0:33.205 aoe L incinerate Fluffy_Pillow 47018.5/50000: 94% mana
2.0/5: 40% soul_shard
bloodlust
0:34.545 aoe J conflagrate Fluffy_Pillow 46688.5/50000: 93% mana
2.7/5: 54% soul_shard
bloodlust
0:35.569 aoe E channel_demonfire Fluffy_Pillow 46700.5/50000: 93% mana
3.3/5: 66% soul_shard
bloodlust, backdraft
0:37.965 aoe H havoc enemy2 47148.5/50000: 94% mana
3.8/5: 76% soul_shard
bloodlust, backdraft
0:38.973 havoc Q chaos_bolt Fluffy_Pillow 46652.5/50000: 93% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:40.380 havoc Q chaos_bolt Fluffy_Pillow 47356.0/50000: 95% mana
2.1/5: 42% soul_shard
bloodlust
0:42.389 havoc R incinerate Fluffy_Pillow 48360.5/50000: 97% mana
0.4/5: 8% soul_shard
0:44.129 havoc P immolate Fluffy_Pillow 48230.5/50000: 96% mana
0.9/5: 18% soul_shard
0:45.435 havoc N conflagrate Fluffy_Pillow 48133.5/50000: 96% mana
1.2/5: 24% soul_shard
0:46.740 havoc Q chaos_bolt Fluffy_Pillow 48286.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft
0:48.568 default 9 soul_fire Fluffy_Pillow 49200.0/50000: 98% mana
0.6/5: 12% soul_shard
0:52.045 aoe F immolate enemy3 49002.0/50000: 98% mana
2.0/5: 40% soul_shard
0:53.351 aoe J conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
2.4/5: 48% soul_shard
0:54.656 aoe F immolate enemy2 49057.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
0:55.962 aoe E channel_demonfire Fluffy_Pillow 48960.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
0:58.672 aoe I rain_of_fire Fluffy_Pillow 49565.5/50000: 99% mana
3.5/5: 70% soul_shard
backdraft
0:59.977 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
1:01.195 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
1:02.501 aoe L incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.5/5: 30% soul_shard
backdraft
1:03.721 default A cataclysm Fluffy_Pillow 48764.5/50000: 98% mana
2.0/5: 40% soul_shard
1:05.462 aoe L incinerate Fluffy_Pillow 49135.0/50000: 98% mana
2.2/5: 44% soul_shard
1:07.203 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.5/5: 50% soul_shard
1:08.533 aoe H havoc enemy2 49167.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
1:09.838 havoc Q chaos_bolt Fluffy_Pillow 48820.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
1:11.664 havoc R incinerate Fluffy_Pillow 49733.0/50000: 99% mana
1.6/5: 32% soul_shard
1:13.405 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
1:16.013 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
1:17.321 havoc R incinerate Fluffy_Pillow 49253.0/50000: 99% mana
0.6/5: 12% soul_shard
1:19.061 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
1:20.367 aoe E channel_demonfire Fluffy_Pillow 49155.0/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
1:23.236 aoe L incinerate Fluffy_Pillow 49839.5/50000: 100% mana
2.6/5: 52% soul_shard
backdraft
1:24.454 aoe F immolate enemy3 49001.5/50000: 98% mana
3.2/5: 64% soul_shard
1:25.761 aoe I rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.2/5: 64% soul_shard
1:27.067 aoe J conflagrate Fluffy_Pillow 49558.0/50000: 99% mana
0.6/5: 12% soul_shard
1:28.374 aoe K impending_catastrophe Fluffy_Pillow 49711.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
1:30.114 aoe L incinerate Fluffy_Pillow 48002.0/50000: 96% mana
1.4/5: 28% soul_shard
backdraft
1:31.334 aoe L incinerate Fluffy_Pillow 47612.0/50000: 95% mana
1.8/5: 36% soul_shard
1:33.074 aoe J conflagrate Fluffy_Pillow 47482.0/50000: 95% mana
2.1/5: 42% soul_shard
1:34.479 aoe L incinerate Fluffy_Pillow 47684.5/50000: 95% mana
2.8/5: 56% soul_shard
backdraft
1:35.698 default A cataclysm Fluffy_Pillow 47294.0/50000: 95% mana
3.1/5: 62% soul_shard
1:37.438 default 9 soul_fire Fluffy_Pillow 47664.0/50000: 95% mana
3.5/5: 70% soul_shard
1:40.917 aoe H havoc enemy2 48403.5/50000: 97% mana
4.8/5: 96% soul_shard
1:42.224 havoc Q chaos_bolt Fluffy_Pillow 48057.0/50000: 96% mana
5.0/5: 100% soul_shard
1:44.835 havoc N conflagrate Fluffy_Pillow 49362.5/50000: 99% mana
3.0/5: 60% soul_shard
1:46.142 havoc Q chaos_bolt Fluffy_Pillow 49516.0/50000: 99% mana
4.2/5: 84% soul_shard
backdraft
1:47.970 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.5/5: 50% soul_shard
1:50.579 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.8/5: 16% soul_shard
1:51.885 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
0.8/5: 16% soul_shard
1:54.827 aoe J conflagrate Fluffy_Pillow 49973.0/50000: 100% mana
1.3/5: 26% soul_shard
1:56.134 aoe F immolate enemy3 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
backdraft
1:57.440 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
1:58.660 aoe L incinerate Fluffy_Pillow 48862.0/50000: 98% mana
2.5/5: 50% soul_shard
2:00.400 aoe J conflagrate Fluffy_Pillow 48732.0/50000: 97% mana
2.8/5: 56% soul_shard
2:01.705 aoe I rain_of_fire Fluffy_Pillow 48884.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
2:03.013 aoe L incinerate Fluffy_Pillow 49538.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
2:04.233 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:05.973 aoe L incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.3/5: 26% soul_shard
2:07.711 default A cataclysm Fluffy_Pillow 48741.5/50000: 97% mana
1.8/5: 36% soul_shard
2:09.451 aoe J conflagrate Fluffy_Pillow 49111.5/50000: 98% mana
2.4/5: 48% soul_shard
2:10.756 aoe H havoc enemy2 49264.0/50000: 99% mana
3.0/5: 60% soul_shard
backdraft
2:12.222 havoc Q chaos_bolt Fluffy_Pillow 48997.0/50000: 98% mana
3.3/5: 66% soul_shard
backdraft
2:14.049 havoc R incinerate Fluffy_Pillow 49910.5/50000: 100% mana
1.5/5: 30% soul_shard
2:15.790 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
2:18.398 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
2:19.704 havoc R incinerate Fluffy_Pillow 49252.0/50000: 99% mana
0.5/5: 10% soul_shard
2:21.444 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.2/5: 24% soul_shard
2:22.752 aoe E channel_demonfire Fluffy_Pillow 49156.0/50000: 98% mana
2.4/5: 48% soul_shard
backdraft
2:25.584 aoe L incinerate Fluffy_Pillow 49822.0/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
2:26.803 default 9 soul_fire Fluffy_Pillow 49002.0/50000: 98% mana
3.1/5: 62% soul_shard
2:30.279 aoe F immolate enemy3 49001.5/50000: 98% mana
4.4/5: 88% soul_shard
2:31.585 aoe F immolate Fluffy_Pillow 48904.5/50000: 98% mana
4.7/5: 94% soul_shard
2:32.894 aoe F immolate enemy2 48809.0/50000: 98% mana
4.9/5: 98% soul_shard
2:34.202 aoe I rain_of_fire Fluffy_Pillow 48713.0/50000: 97% mana
5.0/5: 100% soul_shard
2:35.508 aoe J conflagrate Fluffy_Pillow 49366.0/50000: 99% mana
2.3/5: 46% soul_shard
2:36.815 aoe K impending_catastrophe Fluffy_Pillow 49519.5/50000: 99% mana
2.9/5: 58% soul_shard
backdraft
2:38.556 aoe I rain_of_fire Fluffy_Pillow 48002.5/50000: 96% mana
3.1/5: 62% soul_shard
backdraft
2:39.863 default A cataclysm Fluffy_Pillow 48656.0/50000: 97% mana
0.2/5: 4% soul_shard
backdraft
2:41.602 aoe H havoc enemy2 49025.5/50000: 98% mana
0.5/5: 10% soul_shard
backdraft
2:42.910 havoc R incinerate Fluffy_Pillow 48679.5/50000: 97% mana
0.5/5: 10% soul_shard
backdraft
2:44.131 havoc N conflagrate Fluffy_Pillow 48290.0/50000: 97% mana
1.1/5: 22% soul_shard
2:45.437 havoc Q chaos_bolt Fluffy_Pillow 48443.0/50000: 97% mana
2.2/5: 44% soul_shard
backdraft
2:47.265 havoc R incinerate Fluffy_Pillow 49357.0/50000: 99% mana
0.7/5: 14% soul_shard
2:49.005 havoc N conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:50.312 havoc Q chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
2:52.140 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
2:53.447 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
2:54.753 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
2:57.602 aoe F immolate enemy2 49926.5/50000: 100% mana
2.8/5: 56% soul_shard
backdraft
2:58.911 aoe L incinerate Fluffy_Pillow 49253.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:00.132 aoe F immolate enemy3 48864.0/50000: 98% mana
3.2/5: 64% soul_shard
3:01.437 aoe I rain_of_fire Fluffy_Pillow 48766.5/50000: 98% mana
3.2/5: 64% soul_shard
3:02.743 aoe J conflagrate Fluffy_Pillow 49419.5/50000: 99% mana
0.6/5: 12% soul_shard
3:04.050 cds M summon_infernal Fluffy_Pillow 49573.0/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
3:05.358 aoe L incinerate Fluffy_Pillow 49227.0/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
3:06.578 aoe L incinerate Fluffy_Pillow 48837.0/50000: 98% mana
2.1/5: 42% soul_shard
3:08.318 aoe D rain_of_fire Fluffy_Pillow 48707.0/50000: 97% mana
3.0/5: 60% soul_shard
3:09.624 aoe J conflagrate Fluffy_Pillow 49360.0/50000: 99% mana
0.5/5: 10% soul_shard
3:10.931 aoe L incinerate Fluffy_Pillow 49513.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
3:12.151 default A cataclysm Fluffy_Pillow 49002.5/50000: 98% mana
2.1/5: 42% soul_shard
3:13.893 aoe H havoc enemy2 49373.5/50000: 99% mana
2.7/5: 54% soul_shard
3:15.199 havoc O soul_fire Fluffy_Pillow 49026.5/50000: 98% mana
3.1/5: 62% soul_shard
3:18.754 havoc Q chaos_bolt Fluffy_Pillow 49002.5/50000: 98% mana
5.0/5: 100% soul_shard
3:21.365 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:22.672 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.5/5: 90% soul_shard
backdraft
3:24.500 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
3:25.807 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
3:28.604 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
1.4/5: 28% soul_shard
3:29.911 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
2.2/5: 44% soul_shard
backdraft
3:31.218 aoe F immolate enemy2 49252.5/50000: 99% mana
2.8/5: 56% soul_shard
backdraft
3:32.525 aoe D rain_of_fire Fluffy_Pillow 49156.0/50000: 98% mana
3.1/5: 62% soul_shard
backdraft
3:33.830 aoe F immolate enemy3 49808.5/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
3:35.137 aoe L incinerate Fluffy_Pillow 49252.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
3:36.357 aoe J conflagrate Fluffy_Pillow 48862.5/50000: 98% mana
1.2/5: 24% soul_shard
3:37.663 aoe L incinerate Fluffy_Pillow 49015.5/50000: 98% mana
1.8/5: 36% soul_shard
backdraft
3:38.883 aoe K impending_catastrophe Fluffy_Pillow 48625.5/50000: 97% mana
2.2/5: 44% soul_shard
3:40.623 aoe L incinerate Fluffy_Pillow 47495.5/50000: 95% mana
2.4/5: 48% soul_shard
3:42.362 aoe L incinerate Fluffy_Pillow 47365.0/50000: 95% mana
2.8/5: 56% soul_shard
3:44.104 default A cataclysm Fluffy_Pillow 47236.0/50000: 94% mana
3.3/5: 66% soul_shard
3:45.844 aoe H havoc enemy2 47606.0/50000: 95% mana
3.5/5: 70% soul_shard
3:47.151 havoc N conflagrate Fluffy_Pillow 47259.5/50000: 95% mana
3.6/5: 72% soul_shard
3:48.458 havoc Q chaos_bolt Fluffy_Pillow 47413.0/50000: 95% mana
4.8/5: 96% soul_shard
backdraft
3:50.286 havoc Q chaos_bolt Fluffy_Pillow 48327.0/50000: 97% mana
2.9/5: 58% soul_shard
3:52.897 havoc N conflagrate Fluffy_Pillow 49632.5/50000: 99% mana
1.3/5: 26% soul_shard
3:54.204 havoc Q chaos_bolt Fluffy_Pillow 49786.0/50000: 100% mana
2.5/5: 50% soul_shard
backdraft
3:56.032 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.7/5: 14% soul_shard
3:57.339 aoe E channel_demonfire Fluffy_Pillow 49252.5/50000: 99% mana
0.9/5: 18% soul_shard
4:00.210 aoe J conflagrate Fluffy_Pillow 49938.0/50000: 100% mana
1.2/5: 24% soul_shard
4:01.517 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
backdraft
4:02.737 aoe L incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.2/5: 44% soul_shard
4:04.477 default 9 soul_fire Fluffy_Pillow 48872.5/50000: 98% mana
2.7/5: 54% soul_shard
4:07.954 aoe F immolate enemy3 49002.0/50000: 98% mana
4.2/5: 84% soul_shard
4:09.261 aoe F immolate Fluffy_Pillow 48905.5/50000: 98% mana
4.5/5: 90% soul_shard
4:10.568 aoe F immolate enemy2 48809.0/50000: 98% mana
4.5/5: 90% soul_shard
4:11.875 aoe I rain_of_fire Fluffy_Pillow 48712.5/50000: 97% mana
4.9/5: 98% soul_shard
4:13.181 aoe J conflagrate Fluffy_Pillow 49365.5/50000: 99% mana
1.9/5: 38% soul_shard
4:14.487 aoe L incinerate Fluffy_Pillow 49518.5/50000: 99% mana
2.7/5: 54% soul_shard
backdraft
4:15.706 default A cataclysm Fluffy_Pillow 49002.0/50000: 98% mana
2.9/5: 58% soul_shard
4:17.578 aoe H havoc enemy2 49438.0/50000: 99% mana
3.2/5: 64% soul_shard
4:18.883 havoc N conflagrate Fluffy_Pillow 49090.5/50000: 98% mana
3.2/5: 64% soul_shard
4:20.187 havoc Q chaos_bolt Fluffy_Pillow 49242.5/50000: 98% mana
4.5/5: 90% soul_shard
backdraft
4:22.014 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.6/5: 52% soul_shard
4:24.623 havoc R incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
4:26.364 havoc N conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
4:27.671 havoc P immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
4:28.979 aoe E channel_demonfire Fluffy_Pillow 49060.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
4:31.855 aoe I rain_of_fire Fluffy_Pillow 49748.0/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
4:33.161 aoe L incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.6/5: 12% soul_shard
backdraft
4:34.379 aoe L incinerate Fluffy_Pillow 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
4:36.121 aoe F immolate enemy3 48872.5/50000: 98% mana
1.3/5: 26% soul_shard
4:37.426 aoe J conflagrate Fluffy_Pillow 48775.0/50000: 98% mana
1.4/5: 28% soul_shard
4:38.732 aoe L incinerate Fluffy_Pillow 48928.0/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
4:39.953 aoe L incinerate Fluffy_Pillow 48538.5/50000: 97% mana
2.4/5: 48% soul_shard
4:41.694 aoe K impending_catastrophe Fluffy_Pillow 48409.0/50000: 97% mana
2.9/5: 58% soul_shard
4:43.434 aoe I rain_of_fire Fluffy_Pillow 47279.0/50000: 95% mana
3.3/5: 66% soul_shard
4:44.741 aoe J conflagrate Fluffy_Pillow 47932.5/50000: 96% mana
0.3/5: 6% soul_shard
4:46.049 aoe L incinerate Fluffy_Pillow 48086.5/50000: 96% mana
1.2/5: 24% soul_shard
backdraft
4:47.268 aoe L incinerate Fluffy_Pillow 47696.0/50000: 95% mana
1.4/5: 28% soul_shard
4:49.010 default A cataclysm Fluffy_Pillow 47567.0/50000: 95% mana
2.2/5: 44% soul_shard
4:50.750 aoe E channel_demonfire Fluffy_Pillow 47937.0/50000: 96% mana
2.2/5: 44% soul_shard
4:53.520 default 9 soul_fire Fluffy_Pillow 48572.0/50000: 97% mana
2.5/5: 50% soul_shard
4:56.998 aoe H havoc enemy2 49002.5/50000: 98% mana
4.0/5: 80% soul_shard
4:58.305 havoc Q chaos_bolt Fluffy_Pillow 48656.0/50000: 97% mana
4.0/5: 80% soul_shard
5:00.915 havoc N conflagrate Fluffy_Pillow 49961.0/50000: 100% mana
2.3/5: 46% soul_shard
5:02.221 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.6/5: 72% soul_shard
backdraft
5:04.046 havoc N conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
5:05.352 havoc Q chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
backdraft
5:07.179 havoc P immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.3/5: 26% soul_shard
5:08.485 aoe L incinerate Fluffy_Pillow 49252.0/50000: 99% mana
1.3/5: 26% soul_shard
5:10.224 aoe F immolate enemy3 49001.5/50000: 98% mana
1.8/5: 36% soul_shard
5:11.529 aoe J conflagrate Fluffy_Pillow 48904.0/50000: 98% mana
1.8/5: 36% soul_shard
5:12.835 aoe E channel_demonfire Fluffy_Pillow 49057.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="Venthyr_InfernalBrand"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3
covenant=venthyr
soulbind=214:6

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

destruction : 9253 dps, 4981 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
9253.4 9253.4 17.0 / 0.184% 812.8 / 8.8% 20.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
395.8 393.1 Mana 0.00% 38.2 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
destruction 9253
Cataclysm 772 8.4% 9.6 32.48sec 23989 14122 Direct 28.7 6705 13399 7993 19.3%

Stats Details: Cataclysm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.57 28.72 0.00 0.00 1.6987 0.0000 229637.53 229637.53 0.00% 14121.98 14121.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 23.18 14 34 6705.31 6141 7261 6705.07 6476 6932 155395 155395 0.00%
crit 19.30% 5.54 0 13 13398.52 12283 14521 13336.97 0 14407 74242 74242 0.00%

Action Details: Cataclysm

  • id:152108
  • school:shadowflame
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:152108
  • name:Cataclysm
  • school:shadowflame
  • tooltip:
  • description:Calls forth a cataclysm at the target location, dealing {$s1=0} Shadowflame damage to all enemies within $A1 yards and afflicting them with {$?s980=true}[Agony and Unstable Affliction][]$?s104315[Corruption][]{$?s348=true}[Immolate][]$?!s980&!s104315&!s348[Agony, Unstable Affliction, Corruption, or Immolate][].

Action Priority List

    default
    [A]:9.64
  • if_expr:!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
Channel Demonfire 0 (1033) 0.0% (11.2%) 12.2 25.32sec 25160 9340

Stats Details: Channel Demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.21 0.00 182.35 0.00 2.6938 0.1635 0.00 0.00 0.00% 9340.28 9340.28

Action Details: Channel Demonfire

  • id:196447
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:196447
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.

Action Priority List

    aoe
    [E]:12.22
  • if_expr:dot.immolate.remains>cast_time
    Channel Demonfire (_tick) 1033 11.2% 0.0 0.00sec 0 0 Direct 547.0 471 939 561 19.4%

Stats Details: Channel Demonfire Tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 547.04 0.00 0.00 0.0000 0.0000 307136.50 307136.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 441.11 323 556 470.65 263 976 470.97 445 496 207623 207623 0.00%
crit 19.37% 105.94 61 152 939.20 525 1952 939.95 818 1144 99514 99514 0.00%

Action Details: Channel Demonfire Tick

  • id:196448
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.193600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:196448
  • name:Channel Demonfire
  • school:fire
  • tooltip:
  • description:{$@spelldesc196447=Launches {$s1=15} bolts of felfire over {$d=3 seconds} at random targets afflicted by your Immolate within $196449A1 yds. Each bolt deals {$196448s1=0} Fire damage to the target and {$196448s2=0} Fire damage to nearby enemies.}
Chaos Bolt 1250 (1704) 13.5% (18.4%) 21.9 13.20sec 23132 11756 Direct 43.5 (86.5) 0 8531 8531 100.0% (59.7%)

Stats Details: Chaos Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.87 43.52 0.00 0.00 1.9677 0.0000 371256.82 371256.82 0.00% 11756.41 11756.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 43.52 32 56 8530.72 5861 11548 8530.73 8294 8691 371257 371257 0.00%

Action Details: Chaos Bolt

  • id:116858
  • school:chromatic
  • range:40.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116858
  • name:Chaos Bolt
  • school:chromatic
  • tooltip:
  • description:Unleashes a devastating blast of chaos, dealing a critical strike for ${2*{$s1=0}} Chaos damage. Damage is further increased by your critical strike chance.

Action Priority List

    havoc
    [P]:21.96
  • if_expr:cast_time<havoc_remains
    Internal Combustion 454 4.9% 43.0 13.23sec 3129 0 Direct 43.0 2633 5266 3130 18.8%

Stats Details: Internal Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.00 43.00 0.00 0.00 0.0000 0.0000 134551.07 134551.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.16% 34.89 21 49 2633.17 1 3715 2635.24 2429 2830 91895 91895 0.00%
crit 18.84% 8.10 1 18 5265.64 71 7428 5265.14 4046 6397 42656 42656 0.00%

Action Details: Internal Combustion

  • id:266134
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:266134
  • name:Internal Combustion
  • school:fire
  • tooltip:
  • description:Chaos Bolt consumes up to {$s1=5} sec of Immolate's damage over time effect on your target, instantly dealing that much damage.
Conflagrate 806 8.7% 36.8 7.95sec 6514 5214 Direct 55.7 3601 7213 4305 19.4%

Stats Details: Conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.78 55.69 0.00 0.00 1.2494 0.0000 239593.77 239593.77 0.00% 5213.89 5213.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 44.87 31 60 3600.79 2047 5042 3600.11 3380 3841 161541 161541 0.00%
crit 19.43% 10.82 3 20 7213.32 4095 10084 7214.40 5500 8499 78053 78053 0.00%

Action Details: Conflagrate

  • id:17962
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.960
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.5

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:
  • description:Triggers an explosion on the target, dealing {$s1=0} Fire damage.{$?s196406=false}[ Reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}% for {$117828d=10 seconds}.][] |cFFFFFFFFGenerates {$245330s1=5} Soul Shard Fragments.|r

Action Priority List

    aoe
    [J]:17.93
  • if_expr:buff.backdraft.down
    havoc
    [M]:18.84
  • if_expr:buff.backdraft.down&soul_shard>=1&soul_shard<=4
Immolate 1613 17.5% 27.9 10.27sec 17217 13628 Direct 34.8 1537 3064 1829 19.1%
Periodic 344.1 1014 2028 1209 19.2% 95.7%

Stats Details: Immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 27.86 34.81 344.08 344.08 1.2634 2.4817 479715.65 479715.65 0.00% 539.55 13627.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 28.15 19 42 1536.55 819 2017 1536.85 1436 1645 43249 43249 0.00%
crit 19.13% 6.66 1 15 3063.97 1640 4034 3065.98 2241 3735 20405 20405 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 277.92 204 353 1014.13 0 1261 1014.32 997 1032 281882 281882 0.00%
crit 19.23% 66.16 37 103 2028.26 13 2521 2028.39 1916 2125 134180 134180 0.00%

Action Details: Immolate

  • id:348
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:348
  • name:Immolate
  • school:fire
  • tooltip:
  • description:Burns the enemy, causing {$s1=0} Fire damage immediately and an additional $157736o1 Fire damage over {$157736d=18 seconds}. |cFFFFFFFFPeriodic damage generates 1 Soul Shard Fragment and has a {$s2=50}% chance to generate an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [F]:19.56
  • if_expr:remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [O]:8.39
  • if_expr:talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
Incinerate 606 6.6% 46.5 5.87sec 3884 2628 Direct 57.8 (57.8) 2633 5257 3128 18.9% (18.9%)

Stats Details: Incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 46.53 57.78 0.00 0.00 1.4781 0.0000 180736.24 180736.24 0.00% 2627.71 2627.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.13% 46.88 30 69 2632.73 1312 3232 2634.04 2472 2784 123429 123429 0.00%
crit 18.87% 10.90 2 24 5256.78 2625 6464 5248.57 3549 6148 57307 57307 0.00%

Action Details: Incinerate

  • id:29722
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:0.2

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.641000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:
  • description:Draws fire toward the enemy, dealing {$s2=0} Fire damage. |cFFFFFFFFGenerates {$244670s1=2} Soul Shard Fragments and an additional 1 on critical strikes.|r

Action Priority List

    aoe
    [K]:35.14
    havoc
    [Q]:11.65
  • if_expr:cast_time<havoc_remains
Rain of Fire 894 9.7% 17.0 16.75sec 15612 12556 Periodic 402.9 553 1105 659 19.2% 0.0%

Stats Details: Rain Of Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.01 0.00 0.00 402.93 1.2434 0.0000 265536.80 265536.80 0.00% 12556.12 12556.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.77% 325.43 224 460 552.73 507 599 552.71 545 561 179871 179871 0.00%
crit 19.23% 77.50 45 122 1105.43 1013 1198 1105.40 1082 1128 85665 85665 0.00%

Action Details: Rain Of Fire

  • id:5740
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:soul_shard
  • base_cost:3.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5740
  • name:Rain of Fire
  • school:fire
  • tooltip:{$42223s1=0} Fire damage every $5740t2 sec.
  • description:Calls down a rain of hellfire, dealing ${$42223m1*8} Fire damage over {$d=8 seconds} to enemies in the area.

Action Priority List

    aoe
    [D]:5.13
  • if_expr:pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
    aoe
    [I]:11.88
Soul Fire 513 5.5% 5.5 49.55sec 27658 7954 Direct 7.5 16961 34117 20182 18.9%

Stats Details: Soul Fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.50 7.54 0.00 0.00 3.4775 0.0000 152255.82 152255.82 0.00% 7953.60 7953.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 6.11 2 10 16961.42 8602 21176 16977.34 13910 20030 103675 103675 0.00%
crit 18.91% 1.43 0 5 34117.24 17727 42348 26946.87 0 42295 48581 48581 0.00%

Action Details: Soul Fire

  • id:6353
  • school:fire
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:per_hit
  • energize_resource:soul_shard
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:
  • description:Burns the enemy's soul, dealing {$s1=0} Fire damage and applying Immolate. |cFFFFFFFFGenerates ${{$281490s1=10}/10} Soul Shard.|r

Action Priority List

    default
    [9]:4.54
  • if_expr:refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
    havoc
    [N]:1.08
  • if_expr:cast_time<havoc_remains
Summon Infernal 82 0.9% 2.0 180.47sec 11968 10353 Direct 6.0 3348 6696 3992 19.1%

Stats Details: Summon Infernal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 6.00 0.00 0.00 1.1565 0.0000 23935.37 23935.37 0.00% 10352.67 10352.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 4.85 1 6 3348.13 3348 3348 3348.13 3348 3348 16242 16242 0.00%
crit 19.15% 1.15 0 5 6696.27 6696 6696 4670.05 0 6696 7693 7693 0.00%

Action Details: Summon Infernal

  • id:1122
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:1122
  • name:Summon Infernal
  • school:shadow
  • tooltip:
  • description:Summons an Infernal from the Twisting Nether, impacting for {$22703s1=0} Fire damage and stunning all enemies in the area for {$22703d=2 seconds}. The Infernal will serve you for {$111685d=30 seconds}, dealing ${{$20153s1=0}*(100+{$137046s3=0})/100} damage to all nearby enemies every $19483t1 sec and generating {$264365s1=1} Soul Shard Fragment every $264364t1 sec.

Action Priority List

    cds
    [L]:2.00
pet - infernal 3509 / 717
Immolation 3243 7.1% 39.0 5.49sec 4989 0 Direct 117.0 1395 2790 1663 19.2%

Stats Details: Immolation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 39.00 117.00 0.00 0.00 0.0000 0.0000 194576.49 194576.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 94.52 77 106 1395.06 1395 1395 1395.06 1395 1395 131867 131867 0.00%
crit 19.21% 22.48 11 40 2790.11 2790 2790 2790.11 2790 2790 62710 62710 0.00%

Action Details: Immolation

  • id:20153
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:20153
  • name:Immolation
  • school:fire
  • tooltip:
  • description:Deals Fire damage to all nearby enemies.
melee 266 0.6% 41.0 5.25sec 389 271 Direct 41.0 326 651 389 19.6%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.00 41.00 0.00 0.00 1.4367 0.0000 15957.33 22793.44 29.99% 270.90 270.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.45% 32.98 23 40 325.55 326 326 325.55 326 326 10738 15338 29.99%
crit 19.55% 8.02 1 18 651.10 651 651 651.10 651 651 5219 7455 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - imp 514 / 514
Firebolt 514 5.6% 92.6 3.21sec 1649 1133 Direct 91.9 1395 2790 1662 19.1%

Stats Details: Firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.61 91.87 0.00 0.00 1.4555 0.0000 152711.25 152711.25 0.00% 1132.96 1132.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 74.28 52 96 1395.06 1395 1395 1395.06 1395 1395 103627 103627 0.00%
crit 19.15% 17.59 7 34 2790.11 2790 2790 2790.11 2790 2790 49084 49084 0.00%

Action Details: Firebolt

  • id:3110
  • school:fire
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r

Action Priority List

    default
    [ ]:93.06
Simple Action Stats Execute Interval
destruction
Havoc 9.5 32.28sec

Stats Details: Havoc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.52 0.00 0.00 0.00 1.2435 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Havoc

  • id:80240
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:80240
  • name:Havoc
  • school:shadow
  • tooltip:Spells cast by the Warlock also hit this target for {$s1=60}% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for {$s1=60}% of normal initial damage.

Action Priority List

    aoe
    [H]:9.52
  • if_expr:!(target=self.target)&active_enemies<4
Summon Imp 1.0 0.00sec

Stats Details: Summon Imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Imp

  • id:688
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:soul_shard
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Backdraft 36.8 0.0 7.9sec 7.9sec 4.1sec 51.04% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_backdraft
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 23.3s
  • trigger_min/max:2.1s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • backdraft_1:51.04%

Spelldata

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate and Chaos Bolt cast times reduced by {$s1=30}%.
  • description:{$@spelldesc196406=Conflagrate reduces the cast time of your next Incinerate or Chaos Bolt by {$117828s1=30}%. Maximum {$?s267115=false}[{$s2=4}][{$s1=2}] charges.}
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.62% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.62%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
infernal - infernal: Embers 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 120.0 (120.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_embers
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • embers_1:100.00%

Spelldata

  • id:264364
  • name:Embers
  • tooltip:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • description:Generates {$264365s1=1} Soul Shard Fragment every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
infernal - infernal: Immolation 2.0 0.0 180.5sec 180.5sec 30.0sec 100.00% 0.00% 39.0 (39.0) 0.0

Buff Details

  • buff initial source:destruction_infernal
  • cooldown name:buff_immolation
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:2.00

Trigger Details

  • interval_min/max:180.0s / 182.7s
  • trigger_min/max:180.0s / 182.7s
  • trigger_pct:100.00%
  • duration_min/max:30.0s / 30.0s

Stack Uptimes

  • immolation_1:100.00%

Spelldata

  • id:19483
  • name:Immolation
  • tooltip:Burns nearby enemies for fire damage every $t1 sec.
  • description:Burns nearby enemies for {$20153s1=0} fire damage every $t1 sec.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 12.89% 8.85% 16.31% 0.8s 0.0s 6.1s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
destruction
soul_fire Soul Shard 6.51 7.14 7.60% 1.10 0.44 5.79%
immolate Soul Shard 344.12 33.02 35.14% 0.10 1.39 4.03%
incinerate Soul Shard 46.57 11.63 12.37% 0.25 0.00 0.03%
conflagrate Soul Shard 36.77 27.83 29.61% 0.76 0.00 0.00%
mana_regen Mana 651.94 117023.60 100.00% 179.50 31505.13 21.21%
immolate_crits Soul Shard 33.03 3.17 3.37% 0.10 0.13 3.99%
incinerate_crits Soul Shard 10.93 1.09 1.16% 0.10 0.00 0.00%
infernal Soul Shard 120.00 10.10 10.75% 0.08 1.90 15.81%
pet - imp
energy_regen Energy 358.38 3533.90 100.00% 9.86 22.74 0.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 393.12 395.84 31519.0 49192.3 47895.0 50000.0
Soul Shard 4.0 0.32 0.32 3.9 2.2 0.0 5.0
Usage Type Count Total Avg RPE APR
destruction
cataclysm Mana 9.6 4791.8 500.0 500.6 47.9
channel_demonfire Mana 12.2 9162.1 750.0 750.6 33.5
chaos_bolt Soul Shard 21.8 43.7 2.0 2.0 11576.1
conflagrate Mana 36.8 18384.9 500.0 499.9 13.0
havoc Mana 9.5 9522.1 1000.0 1000.3 0.0
immolate Mana 27.9 20887.6 750.0 749.7 23.0
incinerate Mana 46.6 46571.0 1000.0 1000.8 3.9
rain_of_fire Soul Shard 17.0 51.0 3.0 3.0 5203.7
soul_fire Mana 6.5 6514.2 1000.0 1183.4 23.4
summon_infernal Mana 2.0 2000.0 1000.0 1000.0 12.0
pet - imp
firebolt Energy 92.6 3704.8 40.0 40.0 41.2

Statistics & Data Analysis

Fight Length
destruction Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
destruction Damage Per Second
Count 618
Mean 9253.43
Minimum 8798.65
Maximum 9812.18
Spread ( max - min ) 1013.53
Range [ ( max - min ) / 2 * 100% ] 5.48%
Standard Deviation 215.9886
5th Percentile 8924.63
95th Percentile 9620.39
( 95th Percentile - 5th Percentile ) 695.75
Mean Distribution
Standard Deviation 8.6883
95.00% Confidence Interval ( 9236.41 - 9270.46 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2093
0.1 Scale Factor Error with Delta=300 399
0.05 Scale Factor Error with Delta=300 1593
0.01 Scale Factor Error with Delta=300 39825
Priority Target DPS
destruction Priority Target Damage Per Second
Count 618
Mean 4981.02
Minimum 4641.84
Maximum 5410.85
Spread ( max - min ) 769.02
Range [ ( max - min ) / 2 * 100% ] 7.72%
Standard Deviation 125.4394
5th Percentile 4782.94
95th Percentile 5171.38
( 95th Percentile - 5th Percentile ) 388.45
Mean Distribution
Standard Deviation 5.0459
95.00% Confidence Interval ( 4971.13 - 4990.91 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2437
0.1 Scale Factor Error with Delta=300 135
0.05 Scale Factor Error with Delta=300 538
0.01 Scale Factor Error with Delta=300 13433
DPS(e)
destruction Damage Per Second (Effective)
Count 618
Mean 9253.43
Minimum 8798.65
Maximum 9812.18
Spread ( max - min ) 1013.53
Range [ ( max - min ) / 2 * 100% ] 5.48%
Damage
destruction Damage
Count 618
Mean 2384355.58
Minimum 1938611.30
Maximum 2909393.03
Spread ( max - min ) 970781.74
Range [ ( max - min ) / 2 * 100% ] 20.36%
DTPS
destruction Damage Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
destruction Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
destruction Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
destruction Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
destruction Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
destruction Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
destructionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
destruction Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
5 0.00 snapshot_stats
6 0.00 soul_fire
7 0.00 incinerate,if=!talent.soul_fire.enabled
Default action list Executed every time the actor is available.
# count action,conditions
8 0.00 call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
9 4.54 soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
A 9.64 cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
B 0.00 call_action_list,name=aoe,if=active_enemies>2
0.00 immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
0.00 immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
C 0.00 call_action_list,name=cds
0.00 channel_demonfire
0.00 scouring_tithe
0.00 decimating_bolt
0.00 havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
0.00 impending_catastrophe
0.00 soul_rot
0.00 variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
0.00 conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
0.00 chaos_bolt,if=buff.dark_soul_instability.up
0.00 chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
0.00 chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
0.00 shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
0.00 chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
0.00 conflagrate,if=charges>1
0.00 incinerate
actions.aoe
# count action,conditions
D 5.13 rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
0.00 soul_rot
E 12.22 channel_demonfire,if=dot.immolate.remains>cast_time
F 19.56 immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
G 0.00 call_action_list,name=cds
H 9.52 havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
I 11.88 rain_of_fire
0.00 havoc,cycle_targets=1,if=!(self.target=target)
0.00 decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
0.00 incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
0.00 soul_fire
J 17.93 conflagrate,if=buff.backdraft.down
0.00 shadowburn,if=target.health.pct<20
0.00 scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
0.00 impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
K 35.14 incinerate
actions.cds
# count action,conditions
L 2.00 summon_infernal
0.00 dark_soul_instability
0.00 potion,if=pet.infernal.active
0.00 berserking,if=pet.infernal.active
0.00 blood_fury,if=pet.infernal.active
0.00 fireblood,if=pet.infernal.active
0.00 use_items,if=pet.infernal.active|target.time_to_die<20
actions.havoc
# count action,conditions
M 18.84 conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
N 1.08 soul_fire,if=cast_time<havoc_remains
0.00 decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
0.00 scouring_tithe
O 8.39 immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
P 21.96 chaos_bolt,if=cast_time<havoc_remains
0.00 shadowburn
Q 11.65 incinerate,if=cast_time<havoc_remains

Sample Sequence

36AELHPMPMOPMPMDFEFFDKJKKDJKAKIHQMPQMOP9EFJIKKFJKAKHMPPQOMEIKFJKKKKIJA9EHMPPQMOKFIKJKEKAIJKKHQMPPOQM9EFFIJAKJIHQQPQMOEKFIJLKKJDAKKHMNPPMDEFFFKIJKKKAHMPQMPQOEFIJFK9JIKKAHMPQPQMOEFKFIJKKJKKIAHQMPNMOEIKKFIJK

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 3 summon_imp Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
Pre precombat 6 soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.0/5: 60% soul_shard
0:00.000 default A cataclysm Fluffy_Pillow 49000.0/50000: 98% mana
4.0/5: 80% soul_shard
0:01.740 aoe E channel_demonfire Fluffy_Pillow 49370.0/50000: 99% mana
4.0/5: 80% soul_shard
bloodlust
0:03.903 cds L summon_infernal Fluffy_Pillow 49701.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust
0:04.909 aoe H havoc enemy2 49204.5/50000: 98% mana
4.6/5: 92% soul_shard
bloodlust
0:05.915 havoc P chaos_bolt Fluffy_Pillow 48707.5/50000: 97% mana
5.0/5: 100% soul_shard
bloodlust
0:07.924 havoc M conflagrate Fluffy_Pillow 49712.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust
0:08.931 havoc P chaos_bolt Fluffy_Pillow 49715.5/50000: 99% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:10.339 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.7/5: 54% soul_shard
bloodlust
0:11.347 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
3.9/5: 78% soul_shard
bloodlust, backdraft
0:12.354 havoc P chaos_bolt Fluffy_Pillow 49252.5/50000: 99% mana
4.4/5: 88% soul_shard
bloodlust, backdraft
0:13.762 havoc M conflagrate Fluffy_Pillow 49956.5/50000: 100% mana
3.0/5: 60% soul_shard
bloodlust
0:14.769 havoc P chaos_bolt Fluffy_Pillow 49960.0/50000: 100% mana
4.3/5: 86% soul_shard
bloodlust, backdraft
0:16.175 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.8/5: 56% soul_shard
bloodlust
0:17.182 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
4.2/5: 84% soul_shard
bloodlust, backdraft
0:18.187 aoe F immolate Fluffy_Pillow 50000.0/50000: 100% mana
1.7/5: 34% soul_shard
bloodlust, backdraft
0:19.193 aoe E channel_demonfire Fluffy_Pillow 49252.0/50000: 99% mana
2.0/5: 40% soul_shard
bloodlust, backdraft
0:21.385 aoe F immolate enemy2 49598.0/50000: 99% mana
2.7/5: 54% soul_shard
bloodlust, backdraft
0:22.391 aoe F immolate enemy3 49252.0/50000: 99% mana
3.0/5: 60% soul_shard
bloodlust, backdraft
0:23.399 aoe D rain_of_fire Fluffy_Pillow 49006.0/50000: 98% mana
3.2/5: 64% soul_shard
bloodlust, backdraft
0:24.405 aoe K incinerate Fluffy_Pillow 49509.0/50000: 99% mana
0.7/5: 14% soul_shard
bloodlust, backdraft
0:25.343 aoe J conflagrate Fluffy_Pillow 48978.0/50000: 98% mana
1.0/5: 20% soul_shard
bloodlust
0:26.351 aoe K incinerate Fluffy_Pillow 48982.0/50000: 98% mana
1.9/5: 38% soul_shard
bloodlust, backdraft
0:27.291 aoe K incinerate Fluffy_Pillow 48452.0/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust
0:28.632 aoe D rain_of_fire Fluffy_Pillow 48122.5/50000: 96% mana
3.3/5: 66% soul_shard
bloodlust
0:29.637 aoe J conflagrate Fluffy_Pillow 48625.0/50000: 97% mana
0.6/5: 12% soul_shard
bloodlust
0:30.645 aoe K incinerate Fluffy_Pillow 48629.0/50000: 97% mana
1.5/5: 30% soul_shard
bloodlust, backdraft
0:31.585 default A cataclysm Fluffy_Pillow 48099.0/50000: 96% mana
2.0/5: 40% soul_shard
bloodlust
0:33.077 aoe K incinerate Fluffy_Pillow 48345.0/50000: 97% mana
2.5/5: 50% soul_shard
bloodlust
0:34.418 aoe I rain_of_fire Fluffy_Pillow 48015.5/50000: 96% mana
3.2/5: 64% soul_shard
bloodlust
0:35.423 aoe H havoc enemy2 48518.0/50000: 97% mana
0.3/5: 6% soul_shard
bloodlust
0:36.431 havoc Q incinerate Fluffy_Pillow 48022.0/50000: 96% mana
0.5/5: 10% soul_shard
bloodlust
0:37.773 havoc M conflagrate Fluffy_Pillow 47693.0/50000: 95% mana
1.1/5: 22% soul_shard
bloodlust
0:38.779 havoc P chaos_bolt Fluffy_Pillow 47696.0/50000: 95% mana
2.2/5: 44% soul_shard
bloodlust, backdraft
0:40.185 havoc Q incinerate Fluffy_Pillow 48399.0/50000: 97% mana
0.5/5: 10% soul_shard
bloodlust
0:41.524 havoc M conflagrate Fluffy_Pillow 48068.5/50000: 96% mana
1.1/5: 22% soul_shard
0:42.829 havoc O immolate Fluffy_Pillow 48221.0/50000: 96% mana
2.3/5: 46% soul_shard
backdraft
0:44.135 havoc P chaos_bolt Fluffy_Pillow 48124.0/50000: 96% mana
2.5/5: 50% soul_shard
backdraft
0:45.962 default 9 soul_fire Fluffy_Pillow 49037.5/50000: 98% mana
0.7/5: 14% soul_shard
0:49.441 aoe E channel_demonfire Fluffy_Pillow 49003.0/50000: 98% mana
2.1/5: 42% soul_shard
0:52.327 aoe F immolate enemy3 49696.0/50000: 99% mana
2.5/5: 50% soul_shard
0:53.633 aoe J conflagrate Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
0:54.940 aoe I rain_of_fire Fluffy_Pillow 49405.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
0:56.248 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
0:57.467 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
0.9/5: 18% soul_shard
0:59.208 aoe F immolate enemy2 48872.5/50000: 98% mana
1.2/5: 24% soul_shard
1:00.515 aoe J conflagrate Fluffy_Pillow 48776.0/50000: 98% mana
1.5/5: 30% soul_shard
1:01.824 aoe K incinerate Fluffy_Pillow 48930.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
1:03.044 default A cataclysm Fluffy_Pillow 48540.5/50000: 97% mana
2.5/5: 50% soul_shard
1:04.813 aoe K incinerate Fluffy_Pillow 48925.0/50000: 98% mana
2.6/5: 52% soul_shard
1:06.552 aoe H havoc enemy2 48794.5/50000: 98% mana
3.1/5: 62% soul_shard
1:07.857 havoc M conflagrate Fluffy_Pillow 48447.0/50000: 97% mana
3.3/5: 66% soul_shard
1:09.162 havoc P chaos_bolt Fluffy_Pillow 48599.5/50000: 97% mana
4.4/5: 88% soul_shard
backdraft
1:10.991 havoc P chaos_bolt Fluffy_Pillow 49514.0/50000: 99% mana
2.6/5: 52% soul_shard
1:13.601 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
1:15.342 havoc O immolate Fluffy_Pillow 49002.5/50000: 98% mana
1.6/5: 32% soul_shard
1:16.647 havoc M conflagrate Fluffy_Pillow 48905.0/50000: 98% mana
1.8/5: 36% soul_shard
1:17.955 aoe E channel_demonfire Fluffy_Pillow 49059.0/50000: 98% mana
3.0/5: 60% soul_shard
backdraft
1:20.889 aoe I rain_of_fire Fluffy_Pillow 49776.0/50000: 100% mana
3.4/5: 68% soul_shard
backdraft
1:22.196 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
1:23.414 aoe F immolate enemy3 49001.5/50000: 98% mana
0.8/5: 16% soul_shard
1:24.722 aoe J conflagrate Fluffy_Pillow 48905.5/50000: 98% mana
1.0/5: 20% soul_shard
1:26.030 aoe K incinerate Fluffy_Pillow 49059.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
1:27.249 aoe K incinerate Fluffy_Pillow 48669.0/50000: 97% mana
2.0/5: 40% soul_shard
1:28.990 aoe K incinerate Fluffy_Pillow 48539.5/50000: 97% mana
2.5/5: 50% soul_shard
1:30.729 aoe K incinerate Fluffy_Pillow 48409.0/50000: 97% mana
2.8/5: 56% soul_shard
1:32.470 aoe I rain_of_fire Fluffy_Pillow 48279.5/50000: 97% mana
3.3/5: 66% soul_shard
1:33.776 aoe J conflagrate Fluffy_Pillow 48932.5/50000: 98% mana
0.4/5: 8% soul_shard
1:35.084 default A cataclysm Fluffy_Pillow 49086.5/50000: 98% mana
1.1/5: 22% soul_shard
backdraft
1:36.824 default 9 soul_fire Fluffy_Pillow 49456.5/50000: 99% mana
1.4/5: 28% soul_shard
backdraft
1:40.302 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:43.082 aoe H havoc enemy2 49642.5/50000: 99% mana
3.2/5: 64% soul_shard
backdraft
1:44.389 havoc M conflagrate Fluffy_Pillow 49296.0/50000: 99% mana
3.4/5: 68% soul_shard
1:45.696 havoc P chaos_bolt Fluffy_Pillow 49449.5/50000: 99% mana
4.6/5: 92% soul_shard
backdraft
1:47.523 havoc P chaos_bolt Fluffy_Pillow 50000.0/50000: 100% mana
2.9/5: 58% soul_shard
1:50.132 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.2/5: 24% soul_shard
1:51.874 havoc M conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
1.7/5: 34% soul_shard
1:53.180 havoc O immolate Fluffy_Pillow 49156.0/50000: 98% mana
2.8/5: 56% soul_shard
backdraft
1:54.488 aoe K incinerate Fluffy_Pillow 49060.0/50000: 98% mana
2.9/5: 58% soul_shard
backdraft
1:55.708 aoe F immolate enemy3 48670.0/50000: 97% mana
3.2/5: 64% soul_shard
1:57.015 aoe I rain_of_fire Fluffy_Pillow 48573.5/50000: 97% mana
3.4/5: 68% soul_shard
1:58.323 aoe K incinerate Fluffy_Pillow 49227.5/50000: 98% mana
0.6/5: 12% soul_shard
2:00.062 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.0/5: 20% soul_shard
2:01.368 aoe K incinerate Fluffy_Pillow 49154.5/50000: 98% mana
1.6/5: 32% soul_shard
backdraft
2:02.588 aoe E channel_demonfire Fluffy_Pillow 48764.5/50000: 98% mana
2.1/5: 42% soul_shard
2:05.434 aoe K incinerate Fluffy_Pillow 49437.5/50000: 99% mana
2.5/5: 50% soul_shard
2:07.172 default A cataclysm Fluffy_Pillow 49001.0/50000: 98% mana
2.8/5: 56% soul_shard
2:08.913 aoe I rain_of_fire Fluffy_Pillow 49371.5/50000: 99% mana
3.1/5: 62% soul_shard
2:10.220 aoe J conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:11.528 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
2:12.747 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
1.4/5: 28% soul_shard
2:14.488 aoe H havoc enemy2 48872.5/50000: 98% mana
1.7/5: 34% soul_shard
2:15.793 havoc Q incinerate Fluffy_Pillow 48525.0/50000: 97% mana
1.9/5: 38% soul_shard
2:17.534 havoc M conflagrate Fluffy_Pillow 48395.5/50000: 97% mana
2.4/5: 48% soul_shard
2:18.839 havoc P chaos_bolt Fluffy_Pillow 48548.0/50000: 97% mana
3.7/5: 74% soul_shard
backdraft
2:20.667 havoc P chaos_bolt Fluffy_Pillow 49462.0/50000: 99% mana
2.0/5: 40% soul_shard
2:23.275 havoc O immolate Fluffy_Pillow 50000.0/50000: 100% mana
0.3/5: 6% soul_shard
2:24.580 havoc Q incinerate Fluffy_Pillow 49251.5/50000: 99% mana
0.4/5: 8% soul_shard
2:26.320 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
1.1/5: 22% soul_shard
2:27.627 default 9 soul_fire Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:31.105 aoe E channel_demonfire Fluffy_Pillow 49002.5/50000: 98% mana
3.6/5: 72% soul_shard
backdraft
2:33.910 aoe F immolate enemy3 49655.0/50000: 99% mana
4.0/5: 80% soul_shard
backdraft
2:35.216 aoe F immolate enemy2 49252.0/50000: 99% mana
4.1/5: 82% soul_shard
backdraft
2:36.522 aoe I rain_of_fire Fluffy_Pillow 49155.0/50000: 98% mana
4.2/5: 84% soul_shard
2:37.828 aoe J conflagrate Fluffy_Pillow 49808.0/50000: 100% mana
1.4/5: 28% soul_shard
2:39.135 default A cataclysm Fluffy_Pillow 49961.5/50000: 100% mana
2.1/5: 42% soul_shard
backdraft
2:40.875 aoe K incinerate Fluffy_Pillow 49502.0/50000: 99% mana
2.3/5: 46% soul_shard
backdraft
2:42.095 aoe J conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
2.7/5: 54% soul_shard
2:43.637 aoe I rain_of_fire Fluffy_Pillow 49273.5/50000: 99% mana
3.3/5: 66% soul_shard
backdraft
2:44.943 aoe H havoc enemy2 49926.5/50000: 100% mana
0.5/5: 10% soul_shard
backdraft
2:46.247 havoc Q incinerate Fluffy_Pillow 49578.5/50000: 99% mana
0.6/5: 12% soul_shard
backdraft
2:47.467 havoc Q incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.3/5: 26% soul_shard
2:49.207 havoc P chaos_bolt Fluffy_Pillow 48872.5/50000: 98% mana
2.0/5: 40% soul_shard
2:51.818 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
2:53.559 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.0/5: 20% soul_shard
2:54.865 havoc O immolate Fluffy_Pillow 49155.5/50000: 98% mana
2.1/5: 42% soul_shard
backdraft
2:56.173 aoe E channel_demonfire Fluffy_Pillow 49059.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
2:59.021 aoe K incinerate Fluffy_Pillow 49733.5/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
3:00.239 aoe F immolate enemy3 49001.5/50000: 98% mana
3.0/5: 60% soul_shard
3:01.546 aoe I rain_of_fire Fluffy_Pillow 48905.0/50000: 98% mana
3.2/5: 64% soul_shard
3:02.853 aoe J conflagrate Fluffy_Pillow 49558.5/50000: 99% mana
0.4/5: 8% soul_shard
3:04.159 cds L summon_infernal Fluffy_Pillow 49711.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
3:05.463 aoe K incinerate Fluffy_Pillow 49363.5/50000: 99% mana
1.5/5: 30% soul_shard
backdraft
3:06.681 aoe K incinerate Fluffy_Pillow 48972.5/50000: 98% mana
2.1/5: 42% soul_shard
3:08.421 aoe J conflagrate Fluffy_Pillow 48842.5/50000: 98% mana
2.9/5: 58% soul_shard
3:09.728 aoe D rain_of_fire Fluffy_Pillow 48996.0/50000: 98% mana
3.8/5: 76% soul_shard
backdraft
3:11.036 default A cataclysm Fluffy_Pillow 49650.0/50000: 99% mana
1.2/5: 24% soul_shard
backdraft
3:12.776 aoe K incinerate Fluffy_Pillow 49502.0/50000: 99% mana
1.8/5: 36% soul_shard
backdraft
3:13.996 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
2.3/5: 46% soul_shard
3:15.737 aoe H havoc enemy2 48873.0/50000: 98% mana
3.1/5: 62% soul_shard
3:17.045 havoc M conflagrate Fluffy_Pillow 48527.0/50000: 97% mana
3.5/5: 70% soul_shard
3:18.352 havoc N soul_fire Fluffy_Pillow 48680.5/50000: 97% mana
5.0/5: 100% soul_shard
backdraft
3:21.831 havoc P chaos_bolt Fluffy_Pillow 49003.0/50000: 98% mana
5.0/5: 100% soul_shard
backdraft
3:23.657 havoc P chaos_bolt Fluffy_Pillow 49916.0/50000: 100% mana
3.0/5: 60% soul_shard
3:26.267 havoc M conflagrate Fluffy_Pillow 50000.0/50000: 100% mana
2.0/5: 40% soul_shard
3:27.575 aoe D rain_of_fire Fluffy_Pillow 50000.0/50000: 100% mana
3.3/5: 66% soul_shard
backdraft
3:28.882 aoe E channel_demonfire Fluffy_Pillow 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
3:31.705 aoe F immolate enemy3 50000.0/50000: 100% mana
1.8/5: 36% soul_shard
backdraft
3:33.012 aoe F immolate Fluffy_Pillow 49252.5/50000: 99% mana
2.1/5: 42% soul_shard
backdraft
3:34.321 aoe F immolate enemy2 49157.0/50000: 98% mana
2.6/5: 52% soul_shard
backdraft
3:35.629 aoe K incinerate Fluffy_Pillow 49061.0/50000: 98% mana
2.7/5: 54% soul_shard
backdraft
3:36.850 aoe I rain_of_fire Fluffy_Pillow 48671.5/50000: 97% mana
3.1/5: 62% soul_shard
3:38.156 aoe J conflagrate Fluffy_Pillow 49324.5/50000: 99% mana
0.3/5: 6% soul_shard
3:39.462 aoe K incinerate Fluffy_Pillow 49477.5/50000: 99% mana
1.1/5: 22% soul_shard
backdraft
3:40.682 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.4/5: 28% soul_shard
3:42.422 aoe K incinerate Fluffy_Pillow 48872.5/50000: 98% mana
1.8/5: 36% soul_shard
3:44.163 default A cataclysm Fluffy_Pillow 48743.0/50000: 97% mana
2.2/5: 44% soul_shard
3:45.904 aoe H havoc enemy2 49113.5/50000: 98% mana
2.4/5: 48% soul_shard
3:47.211 havoc M conflagrate Fluffy_Pillow 48767.0/50000: 98% mana
2.6/5: 52% soul_shard
3:48.518 havoc P chaos_bolt Fluffy_Pillow 48920.5/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
3:50.347 havoc Q incinerate Fluffy_Pillow 49835.0/50000: 100% mana
1.9/5: 38% soul_shard
3:52.087 havoc M conflagrate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
3:53.393 havoc P chaos_bolt Fluffy_Pillow 49155.0/50000: 98% mana
3.7/5: 74% soul_shard
backdraft
3:55.219 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
1.9/5: 38% soul_shard
3:56.958 havoc O immolate Fluffy_Pillow 49001.5/50000: 98% mana
2.5/5: 50% soul_shard
3:58.262 aoe E channel_demonfire Fluffy_Pillow 48903.5/50000: 98% mana
2.7/5: 54% soul_shard
4:01.019 aoe F immolate enemy2 49532.0/50000: 99% mana
3.0/5: 60% soul_shard
4:02.327 aoe I rain_of_fire Fluffy_Pillow 49253.0/50000: 99% mana
3.1/5: 62% soul_shard
4:03.632 aoe J conflagrate Fluffy_Pillow 49905.5/50000: 100% mana
0.2/5: 4% soul_shard
4:04.939 aoe F immolate enemy3 50000.0/50000: 100% mana
0.9/5: 18% soul_shard
backdraft
4:06.247 aoe K incinerate Fluffy_Pillow 49253.0/50000: 99% mana
1.0/5: 20% soul_shard
backdraft
4:07.467 default 9 soul_fire Fluffy_Pillow 48863.0/50000: 98% mana
1.4/5: 28% soul_shard
4:10.943 aoe J conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
2.9/5: 58% soul_shard
4:12.249 aoe I rain_of_fire Fluffy_Pillow 49154.5/50000: 98% mana
3.5/5: 70% soul_shard
backdraft
4:13.556 aoe K incinerate Fluffy_Pillow 49808.0/50000: 100% mana
0.8/5: 16% soul_shard
backdraft
4:14.776 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.1/5: 22% soul_shard
4:16.518 default A cataclysm Fluffy_Pillow 48873.5/50000: 98% mana
1.5/5: 30% soul_shard
4:18.259 aoe H havoc enemy2 49244.0/50000: 98% mana
1.9/5: 38% soul_shard
4:19.565 havoc M conflagrate Fluffy_Pillow 48897.0/50000: 98% mana
2.1/5: 42% soul_shard
4:20.872 havoc P chaos_bolt Fluffy_Pillow 49050.5/50000: 98% mana
3.2/5: 64% soul_shard
backdraft
4:22.700 havoc Q incinerate Fluffy_Pillow 49964.5/50000: 100% mana
1.5/5: 30% soul_shard
4:24.443 havoc P chaos_bolt Fluffy_Pillow 49003.5/50000: 98% mana
2.1/5: 42% soul_shard
4:27.052 havoc Q incinerate Fluffy_Pillow 50000.0/50000: 100% mana
0.4/5: 8% soul_shard
4:28.791 havoc M conflagrate Fluffy_Pillow 49001.5/50000: 98% mana
1.1/5: 22% soul_shard
4:30.098 havoc O immolate Fluffy_Pillow 49155.0/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
4:31.403 aoe E channel_demonfire Fluffy_Pillow 49057.5/50000: 98% mana
2.3/5: 46% soul_shard
backdraft
4:34.222 aoe F immolate enemy2 49717.0/50000: 99% mana
2.5/5: 50% soul_shard
backdraft
4:35.528 aoe K incinerate Fluffy_Pillow 49252.0/50000: 99% mana
2.6/5: 52% soul_shard
backdraft
4:36.748 aoe F immolate enemy3 48862.0/50000: 98% mana
2.9/5: 58% soul_shard
4:38.056 aoe I rain_of_fire Fluffy_Pillow 48766.0/50000: 98% mana
3.0/5: 60% soul_shard
4:39.362 aoe J conflagrate Fluffy_Pillow 49419.0/50000: 99% mana
0.2/5: 4% soul_shard
4:40.669 aoe K incinerate Fluffy_Pillow 49572.5/50000: 99% mana
0.8/5: 16% soul_shard
backdraft
4:41.889 aoe K incinerate Fluffy_Pillow 49002.5/50000: 98% mana
1.2/5: 24% soul_shard
4:43.631 aoe J conflagrate Fluffy_Pillow 48873.5/50000: 98% mana
1.6/5: 32% soul_shard
4:44.937 aoe K incinerate Fluffy_Pillow 49026.5/50000: 98% mana
2.2/5: 44% soul_shard
backdraft
4:46.156 aoe K incinerate Fluffy_Pillow 48636.0/50000: 97% mana
2.7/5: 54% soul_shard
4:47.896 aoe I rain_of_fire Fluffy_Pillow 48506.0/50000: 97% mana
3.1/5: 62% soul_shard
4:49.204 default A cataclysm Fluffy_Pillow 49160.0/50000: 98% mana
0.3/5: 6% soul_shard
4:50.943 aoe H havoc enemy2 49501.5/50000: 99% mana
0.7/5: 14% soul_shard
4:52.250 havoc Q incinerate Fluffy_Pillow 49155.0/50000: 98% mana
0.8/5: 16% soul_shard
4:53.991 havoc M conflagrate Fluffy_Pillow 49002.5/50000: 98% mana
1.5/5: 30% soul_shard
4:55.297 havoc P chaos_bolt Fluffy_Pillow 49155.5/50000: 98% mana
2.5/5: 50% soul_shard
backdraft
4:57.127 havoc N soul_fire Fluffy_Pillow 50000.0/50000: 100% mana
1.0/5: 20% soul_shard
5:00.606 havoc M conflagrate Fluffy_Pillow 49003.0/50000: 98% mana
3.4/5: 68% soul_shard
5:02.023 havoc O immolate Fluffy_Pillow 49211.5/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:03.329 aoe E channel_demonfire Fluffy_Pillow 49114.5/50000: 98% mana
4.7/5: 94% soul_shard
backdraft
5:06.166 aoe I rain_of_fire Fluffy_Pillow 49783.0/50000: 100% mana
5.0/5: 100% soul_shard
backdraft
5:07.472 aoe K incinerate Fluffy_Pillow 50000.0/50000: 100% mana
2.3/5: 46% soul_shard
backdraft
5:08.691 aoe K incinerate Fluffy_Pillow 49002.0/50000: 98% mana
2.5/5: 50% soul_shard
5:10.431 aoe F immolate enemy3 48872.0/50000: 98% mana
3.0/5: 60% soul_shard
5:11.738 aoe I rain_of_fire Fluffy_Pillow 48775.5/50000: 98% mana
3.1/5: 62% soul_shard
5:13.044 aoe J conflagrate Fluffy_Pillow 49428.5/50000: 99% mana
0.3/5: 6% soul_shard
5:14.349 aoe K incinerate Fluffy_Pillow 49581.0/50000: 99% mana
0.9/5: 18% soul_shard
backdraft

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 171 0 171 171 0
Agility 346 0 346 346 0
Stamina 414 0 434 414 0
Intellect 450 0 2362 2250 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 50000 50000 0
Soul Shard 5 5 0
Spell Power 2362 2250 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 500 500 0
Mastery 44.57% 44.57% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

warlock="destruction"
source=default
spec=destruction
level=60
race=none
role=spell
position=ranged_back
talents=3203012
talent_override=flashover,if=3>3
talent_override=reverse_entropy,if=3>3
talent_override=inferno,if=3>3
talent_override=rain_of_chaos,if=3>3
talent_override=soul_conduit,if=3>3

# Default consumables
potion=disabled
flask=disabled
food=disabled
augmentation=disabled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/soul_fire
actions.precombat+=/incinerate,if=!talent.soul_fire.enabled

# Executed every time the actor is available.
actions=call_action_list,name=havoc,if=havoc_active&active_enemies<5-talent.inferno.enabled+(talent.inferno.enabled&talent.internal_combustion.enabled)
actions+=/soul_fire,cycle_targets=1,if=refreshable&soul_shard<=4&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/cataclysm,if=!(pet.infernal.active&dot.immolate.remains+1>pet.infernal.remains)|spell_targets.cataclysm>1
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/immolate,cycle_targets=1,if=refreshable&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions+=/immolate,if=talent.internal_combustion.enabled&action.chaos_bolt.in_flight&remains<duration*0.5
actions+=/call_action_list,name=cds
actions+=/channel_demonfire
actions+=/scouring_tithe
actions+=/decimating_bolt
actions+=/havoc,cycle_targets=1,if=!(target=self.target)&(dot.immolate.remains>dot.immolate.duration*0.5|!talent.internal_combustion.enabled)
actions+=/impending_catastrophe
actions+=/soul_rot
actions+=/variable,name=pool_soul_shards,value=active_enemies>1&cooldown.havoc.remains<=10|cooldown.summon_infernal.remains<=15&talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15|talent.dark_soul_instability.enabled&cooldown.dark_soul_instability.remains<=15&(cooldown.summon_infernal.remains>target.time_to_die|cooldown.summon_infernal.remains+cooldown.summon_infernal.duration>target.time_to_die)
actions+=/conflagrate,if=buff.backdraft.down&soul_shard>=1.5-0.3*talent.flashover.enabled&!variable.pool_soul_shards
actions+=/chaos_bolt,if=buff.dark_soul_instability.up
actions+=/chaos_bolt,if=buff.backdraft.up&!variable.pool_soul_shards&!talent.eradication.enabled
actions+=/chaos_bolt,if=!variable.pool_soul_shards&talent.eradication.enabled&(debuff.eradication.remains<cast_time|buff.backdraft.up)
actions+=/shadowburn,if=!variable.pool_soul_shards|soul_shard>=4.5
actions+=/chaos_bolt,if=(soul_shard>=4.5-0.2*active_enemies)
actions+=/conflagrate,if=charges>1
actions+=/incinerate

actions.aoe=rain_of_fire,if=pet.infernal.active&(!cooldown.havoc.ready|active_enemies>3)
actions.aoe+=/soul_rot
actions.aoe+=/channel_demonfire,if=dot.immolate.remains>cast_time
actions.aoe+=/immolate,cycle_targets=1,if=remains<5&(!talent.cataclysm.enabled|cooldown.cataclysm.remains>remains)
actions.aoe+=/call_action_list,name=cds
actions.aoe+=/havoc,cycle_targets=1,if=!(target=self.target)&active_enemies<4
actions.aoe+=/rain_of_fire
actions.aoe+=/havoc,cycle_targets=1,if=!(self.target=target)
actions.aoe+=/decimating_bolt,if=(soulbind.lead_by_example.enabled||!talent.fire_and_brimstone.enabled)
actions.aoe+=/incinerate,if=talent.fire_and_brimstone.enabled&buff.backdraft.up&soul_shard<5-0.2*active_enemies
actions.aoe+=/soul_fire
actions.aoe+=/conflagrate,if=buff.backdraft.down
actions.aoe+=/shadowburn,if=target.health.pct<20
actions.aoe+=/scouring_tithe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/impending_catastrophe,if=!(talent.fire_and_brimstone.enabled|talent.inferno.enabled)
actions.aoe+=/incinerate

actions.cds=summon_infernal
actions.cds+=/dark_soul_instability
actions.cds+=/potion,if=pet.infernal.active
actions.cds+=/berserking,if=pet.infernal.active
actions.cds+=/blood_fury,if=pet.infernal.active
actions.cds+=/fireblood,if=pet.infernal.active
actions.cds+=/use_items,if=pet.infernal.active|target.time_to_die<20

actions.havoc=conflagrate,if=buff.backdraft.down&soul_shard>=1&soul_shard<=4
actions.havoc+=/soul_fire,if=cast_time<havoc_remains
actions.havoc+=/decimating_bolt,if=cast_time<havoc_remains&soulbind.lead_by_example.enabled
actions.havoc+=/scouring_tithe
actions.havoc+=/immolate,if=talent.internal_combustion.enabled&remains<duration*0.5|!talent.internal_combustion.enabled&refreshable
actions.havoc+=/chaos_bolt,if=cast_time<havoc_remains
actions.havoc+=/shadowburn
actions.havoc+=/incinerate,if=cast_time<havoc_remains


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500
default_pet=imp

Simulation & Raid Information

Iterations: 634
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 297.6 )

Performance:

Total Events Processed: 30644583
Max Event Queue: 665
Sim Seconds: 188656
CPU Seconds: 65.7812
Physical Seconds: 4.5600
Speed Up: 2868

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_AshenRemains Kyrian_AshenRemains cataclysm 152108 230822 776 5.83 6700 13397 9.6 28.9 19.2% 0.0% 0.0% 0.0% 32.30sec 230822 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains channel_demonfire 196447 0 0 0.00 0 0 11.8 0.0 0.0% 0.0% 0.0% 0.0% 26.26sec 0 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains channel_demonfire_tick 196448 296252 996 106.51 469 941 0.0 528.2 19.4% 0.0% 0.0% 0.0% 0.00sec 296252 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains chaos_bolt 116858 334741 1125 7.47 0 9034 18.6 37.1 100.0% 0.0% 0.0% 0.0% 15.35sec 334741 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains internal_combustion 266134 109693 369 7.27 2559 5108 36.1 36.1 18.9% 0.0% 0.0% 0.0% 15.47sec 109693 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains conflagrate 17962 235043 790 10.99 3622 7219 36.6 54.5 19.2% 0.0% 0.0% 0.0% 7.95sec 235043 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.17sec 0 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains immolate 348 56527 190 6.32 1514 3023 25.1 31.3 19.2% 0.0% 0.0% 0.0% 11.31sec 472568 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains immolate ticks -348 416041 1387 68.83 1014 2030 25.1 344.2 19.1% 0.0% 0.0% 0.0% 11.31sec 472568 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains incinerate 29722 165107 555 10.04 2781 5547 39.2 49.8 19.3% 0.0% 0.0% 0.0% 7.15sec 165107 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains rain_of_fire ticks -5740 287459 958 0.00 553 1105 18.4 0.0 19.4% 0.0% 0.0% 0.0% 15.66sec 287459 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains scouring_tithe 312321 33038 111 3.76 1484 2968 13.3 18.6 19.5% 0.0% 0.0% 0.0% 22.40sec 98201 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains scouring_tithe ticks -312321 65163 217 26.47 413 826 13.3 132.4 19.2% 0.0% 0.0% 0.0% 22.40sec 98201 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains soul_fire 6353 142987 481 1.48 16290 32785 5.5 7.4 19.0% 0.0% 0.0% 0.0% 49.49sec 142987 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains summon_infernal 1122 24152 81 1.21 3348 6696 2.0 6.0 20.2% 0.0% 0.0% 0.0% 180.46sec 24152 297.57sec
Kyrian_AshenRemains Kyrian_AshenRemains_infernal immolation 20153 194617 3244 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194617 60.00sec
Kyrian_AshenRemains Kyrian_AshenRemains_infernal melee 0 15901 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22714 60.00sec
Kyrian_AshenRemains Kyrian_AshenRemains_imp firebolt 3110 152833 514 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152833 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine cataclysm 152108 231292 777 5.83 6705 13420 9.6 28.9 19.2% 0.0% 0.0% 0.0% 32.39sec 231292 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.75sec 0 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine channel_demonfire_tick 196448 297552 1000 107.18 469 939 0.0 531.6 19.3% 0.0% 0.0% 0.0% 0.00sec 297552 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine chaos_bolt 116858 315786 1061 7.47 0 8527 18.6 37.0 100.0% 0.0% 0.0% 0.0% 15.60sec 315786 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine internal_combustion 266134 124058 417 7.27 2887 5817 36.1 36.1 18.9% 0.0% 0.0% 0.0% 15.69sec 124058 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine conflagrate 17962 235654 792 10.98 3621 7241 36.6 54.4 19.5% 0.0% 0.0% 0.0% 7.94sec 235654 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.22sec 0 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine immolate 348 56888 191 6.34 1516 3024 25.2 31.4 19.5% 0.0% 0.0% 0.0% 11.41sec 498262 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine immolate ticks -348 441374 1471 68.81 1078 2155 25.2 344.1 19.0% 0.0% 0.0% 0.0% 11.41sec 498262 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine incinerate 29722 155346 522 10.05 2622 5244 39.1 49.8 19.0% 0.0% 0.0% 0.0% 7.10sec 155346 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine rain_of_fire ticks -5740 287155 957 0.00 553 1106 18.4 0.0 19.2% 0.0% 0.0% 0.0% 15.43sec 287155 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine scouring_tithe 312321 32914 111 3.76 1480 2981 13.3 18.7 18.9% 0.0% 0.0% 0.0% 22.62sec 98206 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine scouring_tithe ticks -312321 65292 218 26.48 413 826 13.3 132.4 19.3% 0.0% 0.0% 0.0% 22.62sec 98206 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine soul_fire 6353 141441 475 1.48 16298 32100 5.5 7.3 18.9% 0.0% 0.0% 0.0% 49.57sec 141441 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine summon_infernal 1122 23979 81 1.21 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.49sec 23979 297.57sec
Kyrian_CombustingEngine Kyrian_CombustingEngine_infernal immolation 20153 194683 3245 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 194683 60.00sec
Kyrian_CombustingEngine Kyrian_CombustingEngine_infernal melee 0 15898 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22709 60.00sec
Kyrian_CombustingEngine Kyrian_CombustingEngine_imp firebolt 3110 152901 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152901 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc cataclysm 152108 231864 779 5.83 6705 13408 9.6 28.9 19.7% 0.0% 0.0% 0.0% 32.32sec 231864 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 26.21sec 0 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc channel_demonfire_tick 196448 297716 1001 107.25 469 940 0.0 531.9 19.3% 0.0% 0.0% 0.0% 0.00sec 297716 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc chaos_bolt 116858 346967 1166 7.49 0 9335 18.7 37.2 100.0% 0.0% 0.0% 0.0% 15.28sec 346967 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc internal_combustion 266134 110217 370 7.30 2560 5125 36.2 36.2 19.0% 0.0% 0.0% 0.0% 15.41sec 110217 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc conflagrate 17962 248653 836 10.99 3818 7675 36.6 54.5 19.3% 0.0% 0.0% 0.0% 7.97sec 248653 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.11sec 0 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc immolate 348 58643 197 6.33 1569 3130 25.2 31.4 19.1% 0.0% 0.0% 0.0% 11.36sec 475756 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc immolate ticks -348 417113 1390 68.86 1015 2029 25.2 344.3 19.4% 0.0% 0.0% 0.0% 11.36sec 475756 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc incinerate 29722 161063 541 10.02 2715 5444 39.1 49.7 19.3% 0.0% 0.0% 0.0% 7.16sec 161063 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc rain_of_fire ticks -5740 286811 956 0.00 553 1106 18.3 0.0 19.3% 0.0% 0.0% 0.0% 15.68sec 286811 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc scouring_tithe 312321 34668 117 3.75 1555 3105 13.3 18.6 19.9% 0.0% 0.0% 0.0% 22.50sec 99819 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc scouring_tithe ticks -312321 65151 217 26.45 413 827 13.3 132.2 19.2% 0.0% 0.0% 0.0% 22.50sec 99819 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc soul_fire 6353 145269 488 1.48 16533 33195 5.5 7.3 19.5% 0.0% 0.0% 0.0% 49.34sec 145269 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc summon_infernal 1122 24147 81 1.21 3348 6696 2.0 6.0 20.2% 0.0% 0.0% 0.0% 180.60sec 24147 297.57sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc_infernal immolation 20153 194240 3237 117.00 1395 2790 39.0 117.0 19.0% 0.0% 0.0% 0.0% 5.49sec 194240 60.00sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc_infernal melee 0 15975 266 41.00 326 651 41.0 41.0 19.7% 0.0% 0.0% 0.0% 5.25sec 22819 60.00sec
Kyrian_DuplicitousHavoc Kyrian_DuplicitousHavoc_imp firebolt 3110 152632 513 18.53 1395 2790 92.6 91.9 19.1% 0.0% 0.0% 0.0% 3.21sec 152632 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand cataclysm 152108 229713 772 5.82 6699 13393 9.6 28.9 18.9% 0.0% 0.0% 0.0% 32.35sec 229713 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 26.26sec 0 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand channel_demonfire_tick 196448 296612 997 107.01 469 936 0.0 530.7 19.2% 0.0% 0.0% 0.0% 0.00sec 296612 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand chaos_bolt 116858 317834 1068 7.52 0 8523 18.7 37.3 100.0% 0.0% 0.0% 0.0% 15.39sec 317834 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand internal_combustion 266134 110647 372 7.32 2557 5096 36.3 36.3 19.4% 0.0% 0.0% 0.0% 15.45sec 110647 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand conflagrate 17962 235371 791 10.97 3622 7254 36.6 54.4 19.3% 0.0% 0.0% 0.0% 7.95sec 235371 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.18sec 0 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand immolate 348 56714 191 6.35 1515 3038 25.2 31.5 18.8% 0.0% 0.0% 0.0% 11.20sec 473095 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand immolate ticks -348 416381 1388 68.82 1015 2029 25.2 344.1 19.3% 0.0% 0.0% 0.0% 11.20sec 473095 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand incinerate 29722 155258 522 10.00 2626 5228 39.0 49.6 19.4% 0.0% 0.0% 0.0% 7.11sec 155258 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand rain_of_fire ticks -5740 285653 952 0.00 553 1106 18.3 0.0 19.1% 0.0% 0.0% 0.0% 15.66sec 285653 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand scouring_tithe 312321 32814 110 3.75 1485 2953 13.3 18.6 19.0% 0.0% 0.0% 0.0% 22.68sec 97930 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand scouring_tithe ticks -312321 65116 217 26.43 413 827 13.3 132.2 19.2% 0.0% 0.0% 0.0% 22.68sec 97930 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand soul_fire 6353 142355 478 1.48 16257 32648 5.5 7.3 19.5% 0.0% 0.0% 0.0% 49.51sec 142355 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand summon_infernal 1122 24022 81 1.21 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.54sec 24022 297.57sec
Kyrian_InfernalBrand Kyrian_InfernalBrand_infernal immolation 20153 213742 3562 117.00 1529 3056 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.49sec 213742 60.00sec
Kyrian_InfernalBrand Kyrian_InfernalBrand_infernal melee 0 15964 266 41.00 326 651 41.0 41.0 19.6% 0.0% 0.0% 0.0% 5.25sec 22803 60.00sec
Kyrian_InfernalBrand Kyrian_InfernalBrand_imp firebolt 3110 152576 513 18.53 1395 2790 92.6 91.9 19.0% 0.0% 0.0% 0.0% 3.21sec 152576 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe cataclysm 152108 231834 779 5.83 6704 13390 9.6 28.9 19.6% 0.0% 0.0% 0.0% 32.29sec 231834 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe channel_demonfire 196447 0 0 0.00 0 0 11.8 0.0 0.0% 0.0% 0.0% 0.0% 26.10sec 0 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe channel_demonfire_tick 196448 295876 994 106.65 469 938 0.0 528.9 19.2% 0.0% 0.0% 0.0% 0.00sec 295876 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe chaos_bolt 116858 315315 1060 7.45 0 8530 18.6 37.0 100.0% 0.0% 0.0% 0.0% 15.52sec 315315 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe internal_combustion 266134 109331 367 7.25 2556 5104 36.0 36.0 18.9% 0.0% 0.0% 0.0% 15.54sec 109331 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe conflagrate 17962 235266 791 10.98 3624 7220 36.5 54.4 19.4% 0.0% 0.0% 0.0% 7.96sec 235266 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.08sec 0 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe immolate 348 56834 191 6.32 1517 3027 25.2 31.3 19.6% 0.0% 0.0% 0.0% 11.36sec 473113 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe immolate ticks -348 416279 1388 68.81 1015 2028 25.2 344.1 19.3% 0.0% 0.0% 0.0% 11.36sec 473113 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe incinerate 29722 155437 522 10.07 2621 5237 39.2 49.9 18.8% 0.0% 0.0% 0.0% 7.12sec 155437 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe rain_of_fire ticks -5740 287933 960 0.00 553 1105 18.4 0.0 19.3% 0.0% 0.0% 0.0% 15.40sec 287933 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe scouring_tithe 312321 33200 112 3.77 1480 2980 13.3 18.7 19.7% 0.0% 0.0% 0.0% 22.47sec 98539 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe scouring_tithe ticks -312321 65339 218 26.54 413 827 13.3 132.7 19.2% 0.0% 0.0% 0.0% 22.47sec 98539 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe soul_fire 6353 143455 482 1.48 16252 32488 5.5 7.4 19.9% 0.0% 0.0% 0.0% 49.42sec 143455 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe summon_infernal 1122 23984 81 1.21 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.54sec 23984 297.57sec
Kyrian_SoulTithe Kyrian_SoulTithe_infernal immolation 20153 194687 3245 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 194687 60.00sec
Kyrian_SoulTithe Kyrian_SoulTithe_infernal melee 0 15874 265 41.00 326 651 41.0 41.0 18.9% 0.0% 0.0% 0.0% 5.25sec 22675 60.00sec
Kyrian_SoulTithe Kyrian_SoulTithe_imp firebolt 3110 152928 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152928 297.57sec
NF_AshenRemains NF_AshenRemains cataclysm 152108 231146 777 5.82 6704 13384 9.6 28.9 19.5% 0.0% 0.0% 0.0% 32.33sec 231146 297.57sec
NF_AshenRemains NF_AshenRemains channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.73sec 0 297.57sec
NF_AshenRemains NF_AshenRemains channel_demonfire_tick 196448 303261 1019 107.52 476 956 0.0 533.2 19.3% 0.0% 0.0% 0.0% 0.00sec 303261 297.57sec
NF_AshenRemains NF_AshenRemains chaos_bolt 116858 385775 1296 8.61 0 9033 21.5 42.7 100.0% 0.0% 0.0% 0.0% 13.42sec 385775 297.57sec
NF_AshenRemains NF_AshenRemains internal_combustion 266134 132715 446 8.55 2630 5263 42.4 42.4 19.0% 0.0% 0.0% 0.0% 13.39sec 132715 297.57sec
NF_AshenRemains NF_AshenRemains conflagrate 17962 239663 805 11.32 3587 7183 36.6 56.1 18.9% 0.0% 0.0% 0.0% 7.95sec 239663 297.57sec
NF_AshenRemains NF_AshenRemains havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.99sec 0 297.57sec
NF_AshenRemains NF_AshenRemains immolate 348 60860 205 6.77 1528 3057 26.4 33.6 18.6% 0.0% 0.0% 0.0% 10.78sec 478001 297.57sec
NF_AshenRemains NF_AshenRemains immolate ticks -348 417140 1390 68.95 1014 2028 26.4 344.8 19.3% 0.0% 0.0% 0.0% 10.78sec 478001 297.57sec
NF_AshenRemains NF_AshenRemains incinerate 29722 183404 616 11.10 2796 5597 44.5 55.1 19.1% 0.0% 0.0% 0.0% 6.11sec 183404 297.57sec
NF_AshenRemains NF_AshenRemains rain_of_fire ticks -5740 272290 908 0.00 553 1106 17.4 0.0 19.2% 0.0% 0.0% 0.0% 16.18sec 272290 297.57sec
NF_AshenRemains NF_AshenRemains soul_fire 6353 152969 514 1.58 16373 32607 5.5 7.8 19.5% 0.0% 0.0% 0.0% 49.46sec 152969 297.57sec
NF_AshenRemains NF_AshenRemains soul_rot ticks -325640 100924 336 19.19 883 1768 5.2 96.0 19.1% 0.0% 0.0% 0.0% 62.60sec 100924 297.57sec
NF_AshenRemains NF_AshenRemains summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
NF_AshenRemains NF_AshenRemains summon_infernal 1122 24017 81 1.21 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.67sec 24017 297.57sec
NF_AshenRemains NF_AshenRemains_infernal immolation 20153 194437 3241 117.00 1395 2790 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.50sec 194437 60.00sec
NF_AshenRemains NF_AshenRemains_infernal melee 0 15874 265 41.00 326 651 41.0 41.0 18.9% 0.0% 0.0% 0.0% 5.25sec 22674 60.00sec
NF_AshenRemains NF_AshenRemains_imp firebolt 3110 153021 514 18.53 1395 2790 92.6 91.9 19.4% 0.0% 0.0% 0.0% 3.21sec 153021 297.57sec
NF_CombustingEngine NF_CombustingEngine cataclysm 152108 230873 776 5.82 6705 13397 9.6 28.9 19.3% 0.0% 0.0% 0.0% 32.32sec 230873 297.57sec
NF_CombustingEngine NF_CombustingEngine channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.75sec 0 297.57sec
NF_CombustingEngine NF_CombustingEngine channel_demonfire_tick 196448 304571 1024 107.87 476 955 0.0 535.0 19.5% 0.0% 0.0% 0.0% 0.00sec 304571 297.57sec
NF_CombustingEngine NF_CombustingEngine chaos_bolt 116858 365172 1227 8.63 0 8527 21.5 42.8 100.0% 0.0% 0.0% 0.0% 13.36sec 365172 297.57sec
NF_CombustingEngine NF_CombustingEngine internal_combustion 266134 149978 504 8.56 2965 5927 42.5 42.5 19.1% 0.0% 0.0% 0.0% 13.35sec 149978 297.57sec
NF_CombustingEngine NF_CombustingEngine conflagrate 17962 240621 809 11.34 3579 7201 36.7 56.2 19.4% 0.0% 0.0% 0.0% 7.93sec 240621 297.57sec
NF_CombustingEngine NF_CombustingEngine havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.91sec 0 297.57sec
NF_CombustingEngine NF_CombustingEngine immolate 348 60985 205 6.78 1527 3048 26.5 33.6 18.8% 0.0% 0.0% 0.0% 10.89sec 504712 297.57sec
NF_CombustingEngine NF_CombustingEngine immolate ticks -348 443728 1479 68.93 1079 2159 26.5 344.6 19.3% 0.0% 0.0% 0.0% 10.89sec 504712 297.57sec
NF_CombustingEngine NF_CombustingEngine incinerate 29722 172432 579 11.03 2639 5288 44.3 54.7 19.4% 0.0% 0.0% 0.0% 6.12sec 172432 297.57sec
NF_CombustingEngine NF_CombustingEngine rain_of_fire ticks -5740 271355 905 0.00 553 1106 17.4 0.0 19.2% 0.0% 0.0% 0.0% 16.31sec 271355 297.57sec
NF_CombustingEngine NF_CombustingEngine soul_fire 6353 152692 513 1.58 16368 32354 5.5 7.8 19.6% 0.0% 0.0% 0.0% 49.40sec 152692 297.57sec
NF_CombustingEngine NF_CombustingEngine soul_rot ticks -325640 101113 337 19.20 883 1765 5.2 96.0 19.3% 0.0% 0.0% 0.0% 62.48sec 101113 297.57sec
NF_CombustingEngine NF_CombustingEngine summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
NF_CombustingEngine NF_CombustingEngine summon_infernal 1122 24044 81 1.21 3348 6696 2.0 6.0 19.7% 0.0% 0.0% 0.0% 180.54sec 24044 297.57sec
NF_CombustingEngine NF_CombustingEngine_infernal immolation 20153 194434 3240 117.00 1395 2790 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.49sec 194434 60.00sec
NF_CombustingEngine NF_CombustingEngine_infernal melee 0 15918 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 22738 60.00sec
NF_CombustingEngine NF_CombustingEngine_imp firebolt 3110 153163 515 18.53 1395 2790 92.6 91.9 19.5% 0.0% 0.0% 0.0% 3.21sec 153163 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc cataclysm 152108 230843 776 5.81 6699 13406 9.6 28.8 19.5% 0.0% 0.0% 0.0% 32.36sec 230843 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.66sec 0 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc channel_demonfire_tick 196448 304327 1023 108.15 476 952 0.0 536.4 19.3% 0.0% 0.0% 0.0% 0.00sec 304327 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc chaos_bolt 116858 399924 1344 8.65 0 9319 21.6 42.9 100.0% 0.0% 0.0% 0.0% 13.40sec 399924 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc internal_combustion 266134 132947 447 8.58 2625 5259 42.5 42.5 19.1% 0.0% 0.0% 0.0% 13.35sec 132947 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc conflagrate 17962 254939 857 11.33 3802 7609 36.7 56.2 19.3% 0.0% 0.0% 0.0% 7.95sec 254939 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.98sec 0 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc immolate 348 63932 215 6.80 1585 3176 26.5 33.7 19.6% 0.0% 0.0% 0.0% 10.71sec 481187 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc immolate ticks -348 417255 1391 68.87 1014 2030 26.5 344.4 19.4% 0.0% 0.0% 0.0% 10.71sec 481187 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc incinerate 29722 176931 595 11.00 2719 5456 44.2 54.5 19.2% 0.0% 0.0% 0.0% 6.17sec 176931 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc rain_of_fire ticks -5740 270955 903 0.00 553 1106 17.3 0.0 19.4% 0.0% 0.0% 0.0% 16.36sec 270955 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc soul_fire 6353 154922 521 1.56 16830 33710 5.5 7.8 18.6% 0.0% 0.0% 0.0% 49.41sec 154922 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc soul_rot ticks -325640 101014 337 19.18 884 1759 5.2 95.9 19.4% 0.0% 0.0% 0.0% 62.37sec 101014 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc summon_infernal 1122 23789 80 1.21 3348 6696 2.0 6.0 18.4% 0.0% 0.0% 0.0% 180.96sec 23789 297.57sec
NF_DuplicitousHavoc NF_DuplicitousHavoc_infernal immolation 20153 194766 3246 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.50sec 194766 60.00sec
NF_DuplicitousHavoc NF_DuplicitousHavoc_infernal melee 0 15878 265 41.00 326 651 41.0 41.0 19.0% 0.0% 0.0% 0.0% 5.26sec 22680 60.00sec
NF_DuplicitousHavoc NF_DuplicitousHavoc_imp firebolt 3110 152833 514 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152833 297.57sec
NF_InfernalBrand NF_InfernalBrand cataclysm 152108 230632 775 5.83 6701 13409 9.6 28.9 19.1% 0.0% 0.0% 0.0% 32.36sec 230632 297.57sec
NF_InfernalBrand NF_InfernalBrand channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.82sec 0 297.57sec
NF_InfernalBrand NF_InfernalBrand channel_demonfire_tick 196448 303672 1021 107.78 476 952 0.0 534.5 19.3% 0.0% 0.0% 0.0% 0.00sec 303672 297.57sec
NF_InfernalBrand NF_InfernalBrand chaos_bolt 116858 366131 1230 8.66 0 8529 21.6 42.9 100.0% 0.0% 0.0% 0.0% 13.19sec 366131 297.57sec
NF_InfernalBrand NF_InfernalBrand internal_combustion 266134 133264 448 8.58 2623 5267 42.6 42.6 19.2% 0.0% 0.0% 0.0% 13.25sec 133264 297.57sec
NF_InfernalBrand NF_InfernalBrand conflagrate 17962 239621 805 11.32 3586 7142 36.6 56.2 19.1% 0.0% 0.0% 0.0% 7.93sec 239621 297.57sec
NF_InfernalBrand NF_InfernalBrand havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 31.97sec 0 297.57sec
NF_InfernalBrand NF_InfernalBrand immolate 348 61493 207 6.78 1527 3057 26.5 33.6 19.7% 0.0% 0.0% 0.0% 10.91sec 478434 297.57sec
NF_InfernalBrand NF_InfernalBrand immolate ticks -348 416941 1390 68.88 1015 2027 26.5 344.4 19.4% 0.0% 0.0% 0.0% 10.91sec 478434 297.57sec
NF_InfernalBrand NF_InfernalBrand incinerate 29722 172156 579 11.03 2638 5268 44.3 54.7 19.3% 0.0% 0.0% 0.0% 6.10sec 172156 297.57sec
NF_InfernalBrand NF_InfernalBrand rain_of_fire ticks -5740 270411 901 0.00 553 1105 17.3 0.0 19.3% 0.0% 0.0% 0.0% 16.43sec 270411 297.57sec
NF_InfernalBrand NF_InfernalBrand soul_fire 6353 152112 511 1.57 16406 32794 5.5 7.8 19.4% 0.0% 0.0% 0.0% 49.38sec 152112 297.57sec
NF_InfernalBrand NF_InfernalBrand soul_rot ticks -325640 101363 338 19.20 883 1768 5.2 96.0 19.6% 0.0% 0.0% 0.0% 62.42sec 101363 297.57sec
NF_InfernalBrand NF_InfernalBrand summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
NF_InfernalBrand NF_InfernalBrand summon_infernal 1122 23610 79 1.21 3348 6696 2.0 6.0 17.5% 0.0% 0.0% 0.0% 180.53sec 23610 297.57sec
NF_InfernalBrand NF_InfernalBrand_infernal immolation 20153 212906 3548 117.00 1529 3063 39.0 117.0 19.0% 0.0% 0.0% 0.0% 5.49sec 212906 60.00sec
NF_InfernalBrand NF_InfernalBrand_infernal melee 0 15956 266 41.00 326 651 41.0 41.0 19.5% 0.0% 0.0% 0.0% 5.25sec 22791 60.00sec
NF_InfernalBrand NF_InfernalBrand_imp firebolt 3110 152930 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152930 297.57sec
NF_SoulEater NF_SoulEater cataclysm 152108 231412 778 5.82 6701 13405 9.6 28.9 19.6% 0.0% 0.0% 0.0% 32.39sec 231412 297.57sec
NF_SoulEater NF_SoulEater channel_demonfire 196447 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 25.46sec 0 297.57sec
NF_SoulEater NF_SoulEater channel_demonfire_tick 196448 303923 1021 107.81 476 954 0.0 534.7 19.4% 0.0% 0.0% 0.0% 0.00sec 303923 297.57sec
NF_SoulEater NF_SoulEater chaos_bolt 116858 365763 1229 8.65 0 8521 21.6 42.9 100.0% 0.0% 0.0% 0.0% 13.36sec 365763 297.57sec
NF_SoulEater NF_SoulEater internal_combustion 266134 132901 447 8.58 2621 5254 42.6 42.6 19.1% 0.0% 0.0% 0.0% 13.33sec 132901 297.57sec
NF_SoulEater NF_SoulEater conflagrate 17962 240451 808 11.32 3580 7189 36.6 56.1 19.6% 0.0% 0.0% 0.0% 7.95sec 240451 297.57sec
NF_SoulEater NF_SoulEater havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.05sec 0 297.57sec
NF_SoulEater NF_SoulEater immolate 348 61239 206 6.79 1525 3056 26.5 33.7 19.2% 0.0% 0.0% 0.0% 10.87sec 478210 297.57sec
NF_SoulEater NF_SoulEater immolate ticks -348 416971 1390 68.91 1014 2029 26.5 344.6 19.3% 0.0% 0.0% 0.0% 10.87sec 478210 297.57sec
NF_SoulEater NF_SoulEater incinerate 29722 172567 580 11.06 2637 5277 44.4 54.9 19.2% 0.0% 0.0% 0.0% 6.11sec 172567 297.57sec
NF_SoulEater NF_SoulEater rain_of_fire ticks -5740 270463 902 0.00 553 1105 17.3 0.0 19.4% 0.0% 0.0% 0.0% 16.25sec 270463 297.57sec
NF_SoulEater NF_SoulEater soul_fire 6353 152546 513 1.57 16395 33253 5.5 7.8 19.3% 0.0% 0.0% 0.0% 49.41sec 152546 297.57sec
NF_SoulEater NF_SoulEater soul_rot ticks -325640 138895 463 19.17 1214 2426 5.2 95.8 19.4% 0.0% 0.0% 0.0% 62.48sec 138895 297.57sec
NF_SoulEater NF_SoulEater summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
NF_SoulEater NF_SoulEater summon_infernal 1122 23979 81 1.21 3348 6696 2.0 6.0 19.4% 0.0% 0.0% 0.0% 180.66sec 23979 297.57sec
NF_SoulEater NF_SoulEater_infernal immolation 20153 194330 3239 117.00 1395 2790 39.0 117.0 19.1% 0.0% 0.0% 0.0% 5.50sec 194330 60.00sec
NF_SoulEater NF_SoulEater_infernal melee 0 15902 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22714 60.00sec
NF_SoulEater NF_SoulEater_imp firebolt 3110 153129 515 18.53 1395 2790 92.6 91.9 19.5% 0.0% 0.0% 0.0% 3.21sec 153129 297.57sec
Necro_AshenRemains Necro_AshenRemains cataclysm 152108 229586 772 5.79 6701 13401 9.6 28.7 19.3% 0.0% 0.0% 0.0% 32.52sec 229586 297.57sec
Necro_AshenRemains Necro_AshenRemains channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.41sec 0 297.57sec
Necro_AshenRemains Necro_AshenRemains channel_demonfire_tick 196448 302057 1015 108.42 472 940 0.0 537.7 19.2% 0.0% 0.0% 0.0% 0.00sec 302057 297.57sec
Necro_AshenRemains Necro_AshenRemains chaos_bolt 116858 401343 1349 8.96 0 9030 22.3 44.4 100.0% 0.0% 0.0% 0.0% 12.82sec 401343 297.57sec
Necro_AshenRemains Necro_AshenRemains internal_combustion 266134 138494 465 8.87 2632 5277 44.0 44.0 19.5% 0.0% 0.0% 0.0% 12.83sec 138494 297.57sec
Necro_AshenRemains Necro_AshenRemains conflagrate 17962 242835 816 11.40 3611 7196 36.7 56.5 19.1% 0.0% 0.0% 0.0% 7.95sec 242835 297.57sec
Necro_AshenRemains Necro_AshenRemains decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 60.49sec 0 297.57sec
Necro_AshenRemains Necro_AshenRemains decimating_bolt_tick_t 327059 29910 101 4.00 1259 2513 0.0 19.9 19.7% 0.0% 0.0% 0.0% 0.00sec 29910 297.57sec
Necro_AshenRemains Necro_AshenRemains havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.33sec 0 297.57sec
Necro_AshenRemains Necro_AshenRemains immolate 348 63072 212 6.94 1536 3070 26.9 34.4 19.3% 0.0% 0.0% 0.0% 10.62sec 478976 297.57sec
Necro_AshenRemains Necro_AshenRemains immolate ticks -348 415904 1386 68.71 1013 2027 26.9 343.6 19.4% 0.0% 0.0% 0.0% 10.62sec 478976 297.57sec
Necro_AshenRemains Necro_AshenRemains incinerate 29722 241258 811 10.06 4056 8155 40.5 49.9 19.1% 0.0% 0.0% 0.0% 6.78sec 241258 297.57sec
Necro_AshenRemains Necro_AshenRemains rain_of_fire ticks -5740 257144 857 0.00 553 1106 16.4 0.0 19.3% 0.0% 0.0% 0.0% 17.48sec 257144 297.57sec
Necro_AshenRemains Necro_AshenRemains soul_fire 6353 151170 508 1.50 17047 34121 5.5 7.5 18.9% 0.0% 0.0% 0.0% 49.51sec 151170 297.57sec
Necro_AshenRemains Necro_AshenRemains summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Necro_AshenRemains Necro_AshenRemains summon_infernal 1122 24049 81 1.21 3348 6696 2.0 6.0 19.7% 0.0% 0.0% 0.0% 180.78sec 24049 297.57sec
Necro_AshenRemains Necro_AshenRemains_infernal immolation 20153 194493 3241 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.50sec 194493 60.00sec
Necro_AshenRemains Necro_AshenRemains_infernal melee 0 15941 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.26sec 22770 60.00sec
Necro_AshenRemains Necro_AshenRemains_imp firebolt 3110 152860 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152860 297.57sec
Necro_CombustingEngine Necro_CombustingEngine cataclysm 152108 229024 770 5.78 6701 13399 9.6 28.7 19.1% 0.0% 0.0% 0.0% 32.49sec 229024 297.57sec
Necro_CombustingEngine Necro_CombustingEngine channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.91sec 0 297.57sec
Necro_CombustingEngine Necro_CombustingEngine channel_demonfire_tick 196448 301885 1015 108.26 472 942 0.0 536.9 19.2% 0.0% 0.0% 0.0% 0.00sec 301885 297.57sec
Necro_CombustingEngine Necro_CombustingEngine chaos_bolt 116858 378738 1273 8.96 0 8520 22.3 44.4 100.0% 0.0% 0.0% 0.0% 12.99sec 378738 297.57sec
Necro_CombustingEngine Necro_CombustingEngine internal_combustion 266134 156169 525 8.87 2976 5950 44.0 44.0 19.3% 0.0% 0.0% 0.0% 12.95sec 156169 297.57sec
Necro_CombustingEngine Necro_CombustingEngine conflagrate 17962 242116 814 11.40 3610 7171 36.7 56.5 18.9% 0.0% 0.0% 0.0% 7.93sec 242116 297.57sec
Necro_CombustingEngine Necro_CombustingEngine decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.11sec 0 297.57sec
Necro_CombustingEngine Necro_CombustingEngine decimating_bolt_tick_t 327059 29600 99 3.99 1257 2512 0.0 19.8 19.1% 0.0% 0.0% 0.0% 0.00sec 29600 297.57sec
Necro_CombustingEngine Necro_CombustingEngine havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.25sec 0 297.57sec
Necro_CombustingEngine Necro_CombustingEngine immolate 348 62824 211 6.93 1537 3078 26.9 34.4 18.9% 0.0% 0.0% 0.0% 10.76sec 503649 297.57sec
Necro_CombustingEngine Necro_CombustingEngine immolate ticks -348 440825 1469 68.68 1076 2152 26.9 343.4 19.3% 0.0% 0.0% 0.0% 10.76sec 503649 297.57sec
Necro_CombustingEngine Necro_CombustingEngine incinerate 29722 227456 764 10.09 3816 7680 40.5 50.0 19.0% 0.0% 0.0% 0.0% 6.64sec 227456 297.57sec
Necro_CombustingEngine Necro_CombustingEngine rain_of_fire ticks -5740 256913 856 0.00 553 1106 16.4 0.0 19.2% 0.0% 0.0% 0.0% 17.17sec 256913 297.57sec
Necro_CombustingEngine Necro_CombustingEngine soul_fire 6353 151984 511 1.50 17088 33979 5.5 7.5 19.4% 0.0% 0.0% 0.0% 49.42sec 151984 297.57sec
Necro_CombustingEngine Necro_CombustingEngine summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Necro_CombustingEngine Necro_CombustingEngine summon_infernal 1122 24179 81 1.21 3348 6696 2.0 6.0 20.4% 0.0% 0.0% 0.0% 180.65sec 24179 297.57sec
Necro_CombustingEngine Necro_CombustingEngine_infernal immolation 20153 195082 3251 117.00 1395 2790 39.0 117.0 19.5% 0.0% 0.0% 0.0% 5.50sec 195082 60.00sec
Necro_CombustingEngine Necro_CombustingEngine_infernal melee 0 15918 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.25sec 22738 60.00sec
Necro_CombustingEngine Necro_CombustingEngine_imp firebolt 3110 152723 513 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152723 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc cataclysm 152108 228728 769 5.79 6701 13397 9.6 28.7 18.9% 0.0% 0.0% 0.0% 32.51sec 228728 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.05sec 0 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc channel_demonfire_tick 196448 301930 1015 108.14 471 945 0.0 536.3 19.4% 0.0% 0.0% 0.0% 0.00sec 301930 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc chaos_bolt 116858 416166 1399 9.00 0 9325 22.4 44.6 100.0% 0.0% 0.0% 0.0% 12.96sec 416166 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc internal_combustion 266134 138461 465 8.92 2630 5268 44.2 44.2 19.0% 0.0% 0.0% 0.0% 12.93sec 138461 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc conflagrate 17962 257674 866 11.40 3827 7642 36.7 56.5 19.2% 0.0% 0.0% 0.0% 7.95sec 257674 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 60.56sec 0 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc decimating_bolt_tick_t 327059 29759 100 3.99 1258 2511 0.0 19.8 19.7% 0.0% 0.0% 0.0% 0.00sec 29759 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.29sec 0 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc immolate 348 65852 221 6.94 1600 3184 27.0 34.4 19.7% 0.0% 0.0% 0.0% 10.76sec 481649 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc immolate ticks -348 415797 1386 68.67 1014 2026 27.0 343.3 19.4% 0.0% 0.0% 0.0% 10.76sec 481649 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc incinerate 29722 232495 781 10.02 3913 7890 40.4 49.7 19.3% 0.0% 0.0% 0.0% 6.64sec 232495 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc rain_of_fire ticks -5740 255623 852 0.00 553 1106 16.3 0.0 19.5% 0.0% 0.0% 0.0% 17.09sec 255623 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc soul_fire 6353 154659 520 1.50 17511 34815 5.5 7.4 18.8% 0.0% 0.0% 0.0% 49.40sec 154659 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc summon_infernal 1122 24223 81 1.21 3348 6696 2.0 6.0 20.6% 0.0% 0.0% 0.0% 180.61sec 24223 297.57sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc_infernal immolation 20153 194678 3245 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 194678 60.00sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc_infernal melee 0 15900 265 41.00 326 651 41.0 41.0 19.1% 0.0% 0.0% 0.0% 5.25sec 22712 60.00sec
Necro_DuplicitousHavoc Necro_DuplicitousHavoc_imp firebolt 3110 153057 514 18.53 1395 2790 92.6 91.9 19.4% 0.0% 0.0% 0.0% 3.21sec 153057 297.57sec
Necro_FatalDec Necro_FatalDec cataclysm 152108 230288 774 5.79 6707 13379 9.6 28.7 19.6% 0.0% 0.0% 0.0% 32.58sec 230288 297.57sec
Necro_FatalDec Necro_FatalDec channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 25.77sec 0 297.57sec
Necro_FatalDec Necro_FatalDec channel_demonfire_tick 196448 301456 1013 108.05 472 944 0.0 535.9 19.2% 0.0% 0.0% 0.0% 0.00sec 301456 297.57sec
Necro_FatalDec Necro_FatalDec chaos_bolt 116858 379166 1274 8.97 0 8526 22.3 44.5 100.0% 0.0% 0.0% 0.0% 13.02sec 379166 297.57sec
Necro_FatalDec Necro_FatalDec internal_combustion 266134 138520 466 8.87 2630 5259 44.0 44.0 19.7% 0.0% 0.0% 0.0% 12.98sec 138520 297.57sec
Necro_FatalDec Necro_FatalDec conflagrate 17962 243517 818 11.39 3602 7257 36.7 56.5 19.4% 0.0% 0.0% 0.0% 7.94sec 243517 297.57sec
Necro_FatalDec Necro_FatalDec decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 59.63sec 0 297.57sec
Necro_FatalDec Necro_FatalDec decimating_bolt_tick_t 327059 34190 115 3.99 1448 2888 0.0 19.8 19.4% 0.0% 0.0% 0.0% 0.00sec 34190 297.57sec
Necro_FatalDec Necro_FatalDec havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.36sec 0 297.57sec
Necro_FatalDec Necro_FatalDec immolate 348 63221 212 6.93 1537 3077 26.9 34.4 19.5% 0.0% 0.0% 0.0% 10.70sec 479658 297.57sec
Necro_FatalDec Necro_FatalDec immolate ticks -348 416438 1388 68.68 1014 2029 26.9 343.4 19.6% 0.0% 0.0% 0.0% 10.70sec 479658 297.57sec
Necro_FatalDec Necro_FatalDec incinerate 29722 227810 766 10.09 3812 7650 40.6 50.0 19.4% 0.0% 0.0% 0.0% 6.67sec 227810 297.57sec
Necro_FatalDec Necro_FatalDec rain_of_fire ticks -5740 257236 857 0.00 553 1105 16.4 0.0 19.2% 0.0% 0.0% 0.0% 17.20sec 257236 297.57sec
Necro_FatalDec Necro_FatalDec soul_fire 6353 152723 513 1.51 17147 33975 5.5 7.5 19.5% 0.0% 0.0% 0.0% 49.34sec 152723 297.57sec
Necro_FatalDec Necro_FatalDec summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Necro_FatalDec Necro_FatalDec summon_infernal 1122 24087 81 1.21 3348 6696 2.0 6.0 19.9% 0.0% 0.0% 0.0% 180.74sec 24087 297.57sec
Necro_FatalDec Necro_FatalDec_infernal immolation 20153 194093 3235 117.00 1395 2790 39.0 117.0 18.9% 0.0% 0.0% 0.0% 5.50sec 194093 60.00sec
Necro_FatalDec Necro_FatalDec_infernal melee 0 15929 265 41.00 326 651 41.0 41.0 19.3% 0.0% 0.0% 0.0% 5.26sec 22754 60.00sec
Necro_FatalDec Necro_FatalDec_imp firebolt 3110 152813 514 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152813 297.57sec
Necro_InfernalBrand Necro_InfernalBrand cataclysm 152108 229498 771 5.79 6701 13398 9.6 28.7 19.2% 0.0% 0.0% 0.0% 32.57sec 229498 297.57sec
Necro_InfernalBrand Necro_InfernalBrand channel_demonfire 196447 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.04sec 0 297.57sec
Necro_InfernalBrand Necro_InfernalBrand channel_demonfire_tick 196448 302602 1017 108.43 471 944 0.0 537.8 19.3% 0.0% 0.0% 0.0% 0.00sec 302602 297.57sec
Necro_InfernalBrand Necro_InfernalBrand chaos_bolt 116858 380405 1278 8.99 0 8529 22.4 44.6 100.0% 0.0% 0.0% 0.0% 12.78sec 380405 297.57sec
Necro_InfernalBrand Necro_InfernalBrand internal_combustion 266134 138913 467 8.90 2633 5257 44.1 44.1 19.6% 0.0% 0.0% 0.0% 12.79sec 138913 297.57sec
Necro_InfernalBrand Necro_InfernalBrand conflagrate 17962 243681 819 11.42 3608 7236 36.7 56.6 19.2% 0.0% 0.0% 0.0% 7.95sec 243681 297.57sec
Necro_InfernalBrand Necro_InfernalBrand decimating_bolt 325289 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.77sec 0 297.57sec
Necro_InfernalBrand Necro_InfernalBrand decimating_bolt_tick_t 327059 29657 100 3.99 1259 2504 0.0 19.8 19.4% 0.0% 0.0% 0.0% 0.00sec 29657 297.57sec
Necro_InfernalBrand Necro_InfernalBrand havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.31sec 0 297.57sec
Necro_InfernalBrand Necro_InfernalBrand immolate 348 63092 212 6.93 1538 3080 26.9 34.4 19.4% 0.0% 0.0% 0.0% 10.55sec 477717 297.57sec
Necro_InfernalBrand Necro_InfernalBrand immolate ticks -348 414625 1382 68.62 1014 2028 26.9 343.1 19.2% 0.0% 0.0% 0.0% 10.55sec 477717 297.57sec
Necro_InfernalBrand Necro_InfernalBrand incinerate 29722 225932 759 10.01 3837 7595 40.4 49.6 19.0% 0.0% 0.0% 0.0% 6.71sec 225932 297.57sec
Necro_InfernalBrand Necro_InfernalBrand rain_of_fire ticks -5740 256181 854 0.00 553 1106 16.4 0.0 19.4% 0.0% 0.0% 0.0% 17.35sec 256181 297.57sec
Necro_InfernalBrand Necro_InfernalBrand soul_fire 6353 151143 508 1.50 17056 34257 5.5 7.4 19.0% 0.0% 0.0% 0.0% 49.40sec 151143 297.57sec
Necro_InfernalBrand Necro_InfernalBrand summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Necro_InfernalBrand Necro_InfernalBrand summon_infernal 1122 23751 80 1.21 3348 6696 2.0 6.0 18.2% 0.0% 0.0% 0.0% 180.59sec 23751 297.57sec
Necro_InfernalBrand Necro_InfernalBrand_infernal immolation 20153 214057 3567 117.00 1529 3059 39.0 117.0 19.6% 0.0% 0.0% 0.0% 5.49sec 214057 60.00sec
Necro_InfernalBrand Necro_InfernalBrand_infernal melee 0 15874 265 41.00 326 651 41.0 41.0 18.9% 0.0% 0.0% 0.0% 5.25sec 22675 60.00sec
Necro_InfernalBrand Necro_InfernalBrand_imp firebolt 3110 152903 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152903 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains cataclysm 152108 230041 773 5.81 6702 13387 9.6 28.8 19.2% 0.0% 0.0% 0.0% 32.44sec 230041 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.04sec 0 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains channel_demonfire_tick 196448 305974 1028 109.63 471 944 0.0 543.7 19.4% 0.0% 0.0% 0.0% 0.00sec 305974 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains chaos_bolt 116858 403670 1357 9.01 0 9036 22.4 44.7 100.0% 0.0% 0.0% 0.0% 12.76sec 403670 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains internal_combustion 266134 139123 468 8.93 2631 5263 44.3 44.3 19.4% 0.0% 0.0% 0.0% 12.71sec 139123 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains conflagrate 17962 238512 802 11.16 3615 7250 36.8 55.4 19.1% 0.0% 0.0% 0.0% 7.94sec 238512 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.22sec 0 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains immolate 348 63868 215 7.00 1538 3071 27.9 34.7 19.7% 0.0% 0.0% 0.0% 10.23sec 478180 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains immolate ticks -348 414312 1381 68.64 1013 2025 27.9 343.2 19.2% 0.0% 0.0% 0.0% 10.23sec 478180 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.91sec 0 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains impending_catastrophe_impact 322167 9164 31 2.79 558 1116 0.0 13.8 18.6% 0.0% 0.0% 0.0% 0.00sec 9164 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains impending_catastrophe_dot ticks -322170 58304 194 20.20 484 967 0.0 101.0 19.4% 0.0% 0.0% 0.0% 0.00sec 58304 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains incinerate 29722 171747 577 10.52 2768 5528 41.5 52.1 19.0% 0.0% 0.0% 0.0% 6.63sec 171747 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains rain_of_fire ticks -5740 255126 850 0.00 553 1106 16.3 0.0 19.4% 0.0% 0.0% 0.0% 17.96sec 255126 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains soul_fire 6353 150408 505 1.52 16676 33721 5.5 7.5 19.4% 0.0% 0.0% 0.0% 49.55sec 150408 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains summon_infernal 1122 24006 81 1.21 3348 6696 2.0 6.0 19.5% 0.0% 0.0% 0.0% 180.52sec 24006 297.57sec
Venthyr_AshenRemains Venthyr_AshenRemains_infernal immolation 20153 194899 3248 117.00 1395 2790 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 194899 60.00sec
Venthyr_AshenRemains Venthyr_AshenRemains_infernal melee 0 15930 265 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22755 60.00sec
Venthyr_AshenRemains Venthyr_AshenRemains_imp firebolt 3110 152926 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152926 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin cataclysm 152108 230946 776 5.81 6702 13388 9.6 28.8 19.6% 0.0% 0.0% 0.0% 32.43sec 230946 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.25sec 0 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin channel_demonfire_tick 196448 306056 1029 109.91 471 942 0.0 545.1 19.3% 0.0% 0.0% 0.0% 0.00sec 306056 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin chaos_bolt 116858 381730 1283 9.03 0 8520 22.5 44.8 100.0% 0.0% 0.0% 0.0% 12.65sec 381730 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin internal_combustion 266134 139647 469 8.96 2632 5251 44.4 44.4 19.5% 0.0% 0.0% 0.0% 12.65sec 139647 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin conflagrate 17962 238368 801 11.16 3621 7194 36.8 55.3 19.2% 0.0% 0.0% 0.0% 7.93sec 238368 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.18sec 0 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin immolate 348 64094 215 7.05 1537 3068 28.0 34.9 19.4% 0.0% 0.0% 0.0% 10.30sec 478837 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin immolate ticks -348 414744 1382 68.64 1013 2025 28.0 343.2 19.3% 0.0% 0.0% 0.0% 10.30sec 478837 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.77sec 0 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin impending_catastrophe_impact 322167 9253 31 2.79 558 1116 0.0 13.8 19.9% 0.0% 0.0% 0.0% 0.00sec 9253 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin impending_catastrophe_dot ticks -322170 95900 320 34.00 473 946 0.0 170.0 19.2% 0.0% 0.0% 0.0% 0.00sec 95900 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin incinerate 29722 161518 543 10.44 2614 5224 41.3 51.8 19.3% 0.0% 0.0% 0.0% 6.59sec 161518 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin rain_of_fire ticks -5740 253372 845 0.00 553 1106 16.2 0.0 19.2% 0.0% 0.0% 0.0% 17.98sec 253372 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin soul_fire 6353 149268 502 1.52 16726 33711 5.5 7.5 18.3% 0.0% 0.0% 0.0% 49.28sec 149268 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin summon_infernal 1122 24087 81 1.21 3348 6696 2.0 6.0 19.9% 0.0% 0.0% 0.0% 180.50sec 24087 297.57sec
Venthyr_CataOrigin Venthyr_CataOrigin_infernal immolation 20153 195242 3254 117.00 1395 2790 39.0 117.0 19.6% 0.0% 0.0% 0.0% 5.49sec 195242 60.00sec
Venthyr_CataOrigin Venthyr_CataOrigin_infernal melee 0 15951 266 41.00 326 651 41.0 41.0 19.5% 0.0% 0.0% 0.0% 5.25sec 22784 60.00sec
Venthyr_CataOrigin Venthyr_CataOrigin_imp firebolt 3110 152824 514 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152824 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine cataclysm 152108 229939 773 5.81 6701 13407 9.6 28.8 19.2% 0.0% 0.0% 0.0% 32.47sec 229939 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.15sec 0 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine channel_demonfire_tick 196448 305386 1026 109.87 471 938 0.0 544.9 19.2% 0.0% 0.0% 0.0% 0.00sec 305386 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine chaos_bolt 116858 379987 1277 8.99 0 8523 22.4 44.6 100.0% 0.0% 0.0% 0.0% 12.83sec 379987 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine internal_combustion 266134 156371 526 8.91 2960 5947 44.2 44.2 19.3% 0.0% 0.0% 0.0% 12.83sec 156371 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine conflagrate 17962 238345 801 11.16 3615 7237 36.8 55.3 19.1% 0.0% 0.0% 0.0% 7.94sec 238345 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine havoc 80240 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 32.28sec 0 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine immolate 348 63940 215 7.01 1538 3090 27.9 34.8 19.4% 0.0% 0.0% 0.0% 10.22sec 504350 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine immolate ticks -348 440410 1468 68.63 1076 2149 27.9 343.2 19.3% 0.0% 0.0% 0.0% 10.22sec 504350 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.88sec 0 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine impending_catastrophe_impact 322167 9197 31 2.79 558 1116 0.0 13.9 18.9% 0.0% 0.0% 0.0% 0.00sec 9197 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine impending_catastrophe_dot ticks -322170 58236 194 20.17 484 967 0.0 100.9 19.4% 0.0% 0.0% 0.0% 0.00sec 58236 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine incinerate 29722 162711 547 10.55 2606 5241 41.4 52.3 19.2% 0.0% 0.0% 0.0% 6.60sec 162711 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine rain_of_fire ticks -5740 254879 850 0.00 553 1105 16.3 0.0 19.2% 0.0% 0.0% 0.0% 17.62sec 254879 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine soul_fire 6353 147822 497 1.51 16720 34031 5.5 7.5 17.7% 0.0% 0.0% 0.0% 49.49sec 147822 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine summon_infernal 1122 24027 81 1.21 3348 6696 2.0 6.0 19.6% 0.0% 0.0% 0.0% 180.56sec 24027 297.57sec
Venthyr_CombustingEngine Venthyr_CombustingEngine_infernal immolation 20153 194748 3246 117.00 1395 2790 39.0 117.0 19.3% 0.0% 0.0% 0.0% 5.49sec 194748 60.00sec
Venthyr_CombustingEngine Venthyr_CombustingEngine_infernal melee 0 15934 266 41.00 326 651 41.0 41.0 19.4% 0.0% 0.0% 0.0% 5.25sec 22760 60.00sec
Venthyr_CombustingEngine Venthyr_CombustingEngine_imp firebolt 3110 152858 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152858 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc cataclysm 152108 230631 775 5.81 6698 13409 9.6 28.8 19.6% 0.0% 0.0% 0.0% 32.41sec 230631 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.23sec 0 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc channel_demonfire_tick 196448 306317 1029 109.91 471 941 0.0 545.1 19.3% 0.0% 0.0% 0.0% 0.00sec 306317 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc chaos_bolt 116858 417029 1401 9.02 0 9325 22.5 44.7 100.0% 0.0% 0.0% 0.0% 12.90sec 417029 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc internal_combustion 266134 139374 468 8.95 2629 5245 44.4 44.4 19.6% 0.0% 0.0% 0.0% 12.87sec 139374 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc conflagrate 17962 252015 847 11.15 3824 7669 36.8 55.3 19.1% 0.0% 0.0% 0.0% 7.93sec 252015 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.16sec 0 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc immolate 348 66249 223 7.03 1592 3176 28.0 34.9 19.4% 0.0% 0.0% 0.0% 10.39sec 481204 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc immolate ticks -348 414955 1383 68.65 1013 2025 28.0 343.3 19.4% 0.0% 0.0% 0.0% 10.39sec 481204 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.88sec 0 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc impending_catastrophe_impact 322167 9197 31 2.79 558 1116 0.0 13.9 19.0% 0.0% 0.0% 0.0% 0.00sec 9197 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc impending_catastrophe_dot ticks -322170 58360 195 20.20 484 967 0.0 101.0 19.5% 0.0% 0.0% 0.0% 0.00sec 58360 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc incinerate 29722 167236 562 10.48 2696 5380 41.4 52.0 19.4% 0.0% 0.0% 0.0% 6.51sec 167236 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc rain_of_fire ticks -5740 253089 844 0.00 553 1106 16.2 0.0 19.2% 0.0% 0.0% 0.0% 17.61sec 253089 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc soul_fire 6353 154025 518 1.52 17141 34291 5.5 7.5 19.2% 0.0% 0.0% 0.0% 49.47sec 154025 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc summon_infernal 1122 23849 80 1.21 3348 6696 2.0 6.0 18.7% 0.0% 0.0% 0.0% 180.39sec 23849 297.57sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc_infernal immolation 20153 194538 3242 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194538 60.00sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc_infernal melee 0 15945 266 41.00 326 651 41.0 41.0 19.5% 0.0% 0.0% 0.0% 5.25sec 22775 60.00sec
Venthyr_DuplicitousHavoc Venthyr_DuplicitousHavoc_imp firebolt 3110 152887 514 18.53 1395 2790 92.6 91.9 19.3% 0.0% 0.0% 0.0% 3.21sec 152887 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand cataclysm 152108 230333 774 5.80 6699 13397 9.6 28.8 19.5% 0.0% 0.0% 0.0% 32.49sec 230333 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand channel_demonfire 196447 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.45sec 0 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand channel_demonfire_tick 196448 306095 1029 109.79 471 942 0.0 544.5 19.3% 0.0% 0.0% 0.0% 0.00sec 306095 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand chaos_bolt 116858 380343 1278 8.99 0 8529 22.4 44.6 100.0% 0.0% 0.0% 0.0% 13.02sec 380343 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand internal_combustion 266134 138683 466 8.92 2627 5265 44.3 44.3 19.2% 0.0% 0.0% 0.0% 12.99sec 138683 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand conflagrate 17962 238272 801 11.14 3615 7246 36.8 55.3 19.2% 0.0% 0.0% 0.0% 7.94sec 238272 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.26sec 0 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand immolate 348 63989 215 7.01 1538 3076 27.9 34.8 19.7% 0.0% 0.0% 0.0% 10.46sec 478364 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand immolate ticks -348 414376 1381 68.63 1012 2028 27.9 343.1 19.2% 0.0% 0.0% 0.0% 10.46sec 478364 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand impending_catastrophe 321792 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 64.52sec 0 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand impending_catastrophe_impact 322167 9257 31 2.79 558 1116 0.0 13.9 19.7% 0.0% 0.0% 0.0% 0.00sec 9257 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand impending_catastrophe_dot ticks -322170 58354 195 20.22 484 967 0.0 101.1 19.4% 0.0% 0.0% 0.0% 0.00sec 58354 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand incinerate 29722 161906 544 10.50 2614 5196 41.5 52.1 19.2% 0.0% 0.0% 0.0% 6.46sec 161906 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand rain_of_fire ticks -5740 253854 846 0.00 553 1105 16.3 0.0 19.2% 0.0% 0.0% 0.0% 17.30sec 253854 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand soul_fire 6353 149873 504 1.52 16707 33365 5.5 7.5 19.0% 0.0% 0.0% 0.0% 49.44sec 149873 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand summon_infernal 1122 23870 80 1.21 3348 6696 2.0 6.0 18.8% 0.0% 0.0% 0.0% 180.50sec 23870 297.57sec
Venthyr_InfernalBrand Venthyr_InfernalBrand_infernal immolation 20153 213788 3563 117.00 1528 3066 39.0 117.0 19.4% 0.0% 0.0% 0.0% 5.49sec 213788 60.00sec
Venthyr_InfernalBrand Venthyr_InfernalBrand_infernal melee 0 15956 266 41.00 326 651 41.0 41.0 19.5% 0.0% 0.0% 0.0% 5.25sec 22791 60.00sec
Venthyr_InfernalBrand Venthyr_InfernalBrand_imp firebolt 3110 152761 513 18.53 1395 2790 92.6 91.9 19.2% 0.0% 0.0% 0.0% 3.21sec 152761 297.57sec
destruction destruction cataclysm 152108 229638 772 5.79 6705 13399 9.6 28.7 19.3% 0.0% 0.0% 0.0% 32.48sec 229638 297.57sec
destruction destruction channel_demonfire 196447 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.32sec 0 297.57sec
destruction destruction channel_demonfire_tick 196448 307137 1032 110.30 471 939 0.0 547.0 19.4% 0.0% 0.0% 0.0% 0.00sec 307137 297.57sec
destruction destruction chaos_bolt 116858 371257 1248 8.77 0 8531 21.9 43.5 100.0% 0.0% 0.0% 0.0% 13.20sec 371257 297.57sec
destruction destruction internal_combustion 266134 134551 452 8.67 2633 5266 43.0 43.0 18.8% 0.0% 0.0% 0.0% 13.23sec 134551 297.57sec
destruction destruction conflagrate 17962 239594 805 11.23 3601 7213 36.8 55.7 19.4% 0.0% 0.0% 0.0% 7.95sec 239594 297.57sec
destruction destruction havoc 80240 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 32.28sec 0 297.57sec
destruction destruction immolate 348 63654 214 7.02 1537 3064 27.9 34.8 19.1% 0.0% 0.0% 0.0% 10.27sec 479716 297.57sec
destruction destruction immolate ticks -348 416062 1387 68.82 1014 2028 27.9 344.1 19.2% 0.0% 0.0% 0.0% 10.27sec 479716 297.57sec
destruction destruction incinerate 29722 180736 607 11.65 2633 5257 46.5 57.8 18.9% 0.0% 0.0% 0.0% 5.87sec 180736 297.57sec
destruction destruction rain_of_fire ticks -5740 265537 885 0.00 553 1105 17.0 0.0 19.2% 0.0% 0.0% 0.0% 16.75sec 265537 297.57sec
destruction destruction soul_fire 6353 152256 512 1.52 16961 34117 5.5 7.5 18.9% 0.0% 0.0% 0.0% 49.55sec 152256 297.57sec
destruction destruction summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.57sec
destruction destruction summon_infernal 1122 23935 80 1.21 3348 6696 2.0 6.0 19.1% 0.0% 0.0% 0.0% 180.47sec 23935 297.57sec
destruction destruction_infernal immolation 20153 194576 3243 117.00 1395 2790 39.0 117.0 19.2% 0.0% 0.0% 0.0% 5.49sec 194576 60.00sec
destruction destruction_infernal melee 0 15957 266 41.00 326 651 41.0 41.0 19.6% 0.0% 0.0% 0.0% 5.25sec 22793 60.00sec
destruction destruction_imp firebolt 3110 152711 513 18.53 1395 2790 92.6 91.9 19.1% 0.0% 0.0% 0.0% 3.21sec 152711 297.57sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
101255.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 52.6sec 12.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 149.9s

Stack Uptimes

  • Health Decade (0 - 10)_1:12.43%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.0sec 8.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.0s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.66%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.6sec 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 42.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.99%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 30.1sec 10.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.7s / 39.2s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.26%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.3s / 38.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.30%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.0sec 11.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.7s / 41.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.56%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.1sec 11.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.0s / 41.7s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.63%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.3sec 10.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.2s / 43.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.65%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 22.6sec 7.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.7s / 31.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:7.68%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 24.6sec 5.95% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.95%
combusting_engine 22.7 14.0 12.9sec 0.0sec 8.7sec 66.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:45.26%
  • combusting_engine_2:20.75%
  • combusting_engine_3:0.45%
combusting_engine 22.0 14.7 13.4sec 0.0sec 8.9sec 66.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:45.33%
  • combusting_engine_2:19.87%
  • combusting_engine_3:0.84%
combusting_engine 21.1 15.1 13.9sec 0.0sec 9.3sec 65.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:43.76%
  • combusting_engine_2:19.79%
  • combusting_engine_3:2.13%
combusting_engine 21.7 15.0 13.6sec 0.0sec 8.6sec 62.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:41.25%
  • combusting_engine_2:20.57%
  • combusting_engine_3:0.56%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.51% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:NF_InfernalBrand_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 185.2s
  • trigger_min/max:1.3s / 155.8s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.05%
  • infernal_brand_2:1.05%
  • infernal_brand_3:1.05%
  • infernal_brand_4:1.05%
  • infernal_brand_5:1.05%
  • infernal_brand_6:1.05%
  • infernal_brand_7:1.05%
  • infernal_brand_8:1.05%
  • infernal_brand_9:1.05%
  • infernal_brand_10:1.05%
  • infernal_brand_11:1.05%
  • infernal_brand_12:1.05%
  • infernal_brand_13:1.05%
  • infernal_brand_14:1.05%
  • infernal_brand_15:10.86%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.1sec 5.2sec 37.5sec 25.51% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Venthyr_InfernalBrand_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 182.8s
  • trigger_min/max:1.3s / 153.5s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.05%
  • infernal_brand_2:1.05%
  • infernal_brand_3:1.05%
  • infernal_brand_4:1.05%
  • infernal_brand_5:1.05%
  • infernal_brand_6:1.05%
  • infernal_brand_7:1.05%
  • infernal_brand_8:1.05%
  • infernal_brand_9:1.05%
  • infernal_brand_10:1.05%
  • infernal_brand_11:1.05%
  • infernal_brand_12:1.05%
  • infernal_brand_13:1.05%
  • infernal_brand_14:1.05%
  • infernal_brand_15:10.86%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.2sec 5.3sec 37.5sec 25.51% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Kyrian_InfernalBrand_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 186.4s
  • trigger_min/max:1.3s / 157.0s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.05%
  • infernal_brand_2:1.05%
  • infernal_brand_3:1.05%
  • infernal_brand_4:1.05%
  • infernal_brand_5:1.05%
  • infernal_brand_6:1.05%
  • infernal_brand_7:1.05%
  • infernal_brand_8:1.05%
  • infernal_brand_9:1.05%
  • infernal_brand_10:1.05%
  • infernal_brand_11:1.05%
  • infernal_brand_12:1.05%
  • infernal_brand_13:1.05%
  • infernal_brand_14:1.05%
  • infernal_brand_15:10.86%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
infernal: Infernal Brand 2.0 39.0 176.3sec 5.3sec 37.5sec 25.51% 0.00% 11.0 (11.0) 2.0

Buff Details

  • buff initial source:Necro_InfernalBrand_infernal
  • cooldown name:buff_infernal_brand
  • max_stacks:15
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 182.6s
  • trigger_min/max:1.3s / 153.2s
  • trigger_pct:100.00%
  • duration_min/max:37.4s / 37.5s

Stack Uptimes

  • infernal_brand_1:1.05%
  • infernal_brand_2:1.05%
  • infernal_brand_3:1.05%
  • infernal_brand_4:1.05%
  • infernal_brand_5:1.05%
  • infernal_brand_6:1.05%
  • infernal_brand_7:1.05%
  • infernal_brand_8:1.05%
  • infernal_brand_9:1.05%
  • infernal_brand_10:1.05%
  • infernal_brand_11:1.05%
  • infernal_brand_12:1.05%
  • infernal_brand_13:1.05%
  • infernal_brand_14:1.05%
  • infernal_brand_15:10.86%

Spelldata

  • id:340045
  • name:Infernal Brand
  • tooltip:Taking $w1% increased Fire damage from Infernal.
  • description:{$@spelldesc340041=Your Infernal's melee attacks cause its target to take |cFFFFFFFF${$s1}.1%|r increased damage from its Immolation, stacking up to {$340045u=15} times.}
  • max_stacks:15
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 19.0 17.8 15.6sec 7.9sec 12.6sec 80.21% 0.00% 17.8 (17.8) 18.2

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.9s
  • trigger_min/max:2.1s / 23.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 41.5s

Stack Uptimes

  • roaring_blaze_1:80.21%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.0 17.6 15.5sec 7.9sec 12.4sec 79.45% 0.00% 17.6 (17.6) 18.2

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 47.5s
  • trigger_min/max:2.0s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.6s

Stack Uptimes

  • roaring_blaze_1:79.45%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.1 17.6 15.4sec 7.9sec 12.4sec 79.50% 0.00% 17.6 (17.6) 18.3

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 49.0s
  • trigger_min/max:2.1s / 24.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.9s

Stack Uptimes

  • roaring_blaze_1:79.50%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.1 17.6 15.5sec 8.0sec 12.4sec 79.32% 0.00% 17.6 (17.6) 18.2

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:2.1s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.1s

Stack Uptimes

  • roaring_blaze_1:79.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.1 17.5 15.4sec 8.0sec 12.4sec 79.53% 0.00% 17.5 (17.5) 18.4

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.7s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.1s

Stack Uptimes

  • roaring_blaze_1:79.53%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 19.1 17.5 15.5sec 8.0sec 12.4sec 79.32% 0.00% 17.5 (17.5) 18.3

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:2.1s / 24.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.9s

Stack Uptimes

  • roaring_blaze_1:79.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.4 18.3 16.1sec 7.9sec 12.9sec 80.05% 0.00% 18.3 (18.3) 17.7

Buff Details

  • buff initial source:Venthyr_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 54.2s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.3s

Stack Uptimes

  • roaring_blaze_1:80.05%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.4 18.3 16.1sec 7.9sec 12.9sec 79.92% 0.00% 18.3 (18.3) 17.7

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.8s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.6s

Stack Uptimes

  • roaring_blaze_1:79.92%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.5 18.3 16.0sec 7.9sec 12.9sec 79.98% 0.00% 18.3 (18.3) 17.7

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 54.0s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.2s

Stack Uptimes

  • roaring_blaze_1:79.98%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.4 18.4 16.1sec 7.9sec 12.9sec 80.00% 0.00% 18.4 (18.4) 17.6

Buff Details

  • buff initial source:Venthyr_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 52.6s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.1s

Stack Uptimes

  • roaring_blaze_1:80.00%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.4 18.4 16.1sec 7.9sec 12.9sec 79.89% 0.00% 18.4 (18.4) 17.6

Buff Details

  • buff initial source:Venthyr_CataOrigin
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 52.3s
  • trigger_min/max:1.9s / 23.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.4s

Stack Uptimes

  • roaring_blaze_1:79.89%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.5 16.3sec 8.0sec 12.9sec 78.39% 0.00% 18.5 (18.5) 17.3

Buff Details

  • buff initial source:Kyrian_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.2s
  • trigger_min/max:1.9s / 23.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.39%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.0 18.6 16.4sec 8.0sec 13.0sec 78.30% 0.00% 18.6 (18.6) 17.2

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.3s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.30%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.0 18.5 16.4sec 8.0sec 12.9sec 78.32% 0.00% 18.5 (18.5) 17.2

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.5s

Stack Uptimes

  • roaring_blaze_1:78.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 18.6 16.4sec 8.0sec 13.0sec 78.24% 0.00% 18.6 (18.6) 17.2

Buff Details

  • buff initial source:Kyrian_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 48.9s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.6s

Stack Uptimes

  • roaring_blaze_1:78.24%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 18.1 18.5 16.3sec 8.0sec 12.9sec 78.29% 0.00% 18.5 (18.5) 17.3

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 50.2s
  • trigger_min/max:1.9s / 23.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.3s

Stack Uptimes

  • roaring_blaze_1:78.29%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.8 18.9 16.6sec 8.0sec 13.1sec 78.30% 0.00% 18.9 (18.9) 17.1

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 50.1s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.9s

Stack Uptimes

  • roaring_blaze_1:78.30%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 18.8 16.5sec 8.0sec 13.0sec 78.37% 0.00% 18.8 (18.8) 17.2

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 51.0s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 43.0s

Stack Uptimes

  • roaring_blaze_1:78.37%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 18.8 16.6sec 8.0sec 13.0sec 78.33% 0.00% 18.8 (18.8) 17.1

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 49.9s
  • trigger_min/max:1.9s / 24.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.7s

Stack Uptimes

  • roaring_blaze_1:78.33%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.7 19.0 16.7sec 8.0sec 13.1sec 78.40% 0.00% 19.0 (19.0) 17.0

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 51.0s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 42.8s

Stack Uptimes

  • roaring_blaze_1:78.40%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 17.9 18.8 16.6sec 7.9sec 13.1sec 78.53% 0.00% 18.8 (18.8) 17.2

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 51.0s
  • trigger_min/max:1.9s / 24.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 43.0s

Stack Uptimes

  • roaring_blaze_1:78.53%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
Fluffy_Pillow Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 618
Mean 107658.64
Minimum 104535.22
Maximum 111311.92
Spread ( max - min ) 6776.70
Range [ ( max - min ) / 2 * 100% ] 3.15%
Standard Deviation 1686.9545
5th Percentile 105306.96
95th Percentile 110364.20
( 95th Percentile - 5th Percentile ) 5057.24
Mean Distribution
Standard Deviation 67.8593
95.00% Confidence Interval ( 107525.64 - 107791.64 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 944
0.1 Scale Factor Error with Delta=300 24294
0.05 Scale Factor Error with Delta=300 97175
0.01 Scale Factor Error with Delta=300 2429352
HPS
Fluffy_Pillow Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 34515616 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
54195.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.8 0.0 0.0sec 0.0sec 56.8sec 13.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 152.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.63%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 29.0sec 8.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 46.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.99%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 29.3sec 9.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.3s / 45.5s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.90%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.8sec 10.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.5s / 35.0s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.15%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.7sec 11.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.3s / 41.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.81%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.3sec 12.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.7s / 49.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.38%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.6s / 49.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.78%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 28.3sec 9.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.5s / 37.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:9.64%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 18.3sec 6.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.2s / 26.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:6.24%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 23.5sec 5.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.4s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.56%
combusting_engine 13.1 6.2 22.5sec 0.0sec 8.1sec 35.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:28.40%
  • combusting_engine_2:7.38%
  • combusting_engine_3:0.08%
combusting_engine 12.5 5.9 23.9sec 0.0sec 7.8sec 32.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:26.29%
  • combusting_engine_2:6.36%
  • combusting_engine_3:0.16%
combusting_engine 12.0 5.2 24.7sec 0.0sec 8.4sec 34.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:28.57%
  • combusting_engine_2:5.28%
  • combusting_engine_3:0.19%
combusting_engine 12.4 7.1 24.2sec 0.0sec 7.7sec 31.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_combusting_engine
  • max_stacks:40
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • combusting_engine_1:24.36%
  • combusting_engine_2:7.43%
  • combusting_engine_3:0.06%
Havoc 9.5 0.0 32.3sec 32.3sec 11.8sec 37.74% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.74%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.8s
  • trigger_min/max:30.0s / 39.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 31.9sec 32.0sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 39.4s
  • trigger_min/max:30.0s / 39.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 37.92% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.5s
  • trigger_min/max:30.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.92%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 37.98% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.9s / 40.0s
  • trigger_min/max:30.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.98%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.0sec 32.0sec 11.8sec 37.97% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.8s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.97%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.2sec 11.8sec 37.89% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_AshenRemains
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.89%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.87% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.87%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.2sec 32.2sec 11.8sec 37.84% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.84%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.2sec 32.3sec 11.8sec 37.83% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_InfernalBrand
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.83%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.2sec 32.3sec 11.8sec 37.83% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Venthyr_CataOrigin
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.83%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.91% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Kyrian_AshenRemains
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.91%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.92% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.7s
  • trigger_min/max:30.0s / 39.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.92%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.93% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.93%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.92% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Kyrian_InfernalBrand
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.92%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.6 0.0 32.1sec 32.2sec 11.8sec 37.93% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.93%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.3sec 32.4sec 11.8sec 37.70% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 40.2s
  • trigger_min/max:30.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.70%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.3sec 32.3sec 11.8sec 37.73% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.9s
  • trigger_min/max:30.0s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 12.0s

Stack Uptimes

  • havoc_1:37.73%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.3sec 32.4sec 11.8sec 37.71% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.6s
  • trigger_min/max:30.0s / 39.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.71%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.3sec 32.4sec 11.8sec 37.72% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.9s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • havoc_1:37.72%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Havoc 9.5 0.0 32.3sec 32.3sec 11.8sec 37.72% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_havoc
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.8s / 39.5s
  • trigger_min/max:30.0s / 39.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • havoc_1:37.72%

Spelldata

  • id:80240
  • name:Havoc
  • tooltip:Spells cast by the Warlock also hit this target for $s1% of normal initial damage.
  • description:Marks a target with Havoc for {$d=10 seconds}, causing your single target spells to also strike the Havoc victim for $s1% of normal initial damage.
  • max_stacks:1
  • duration:10.00
  • cooldown:30.00
  • default_chance:101.00%
Conflagrate (roaring_blaze) 10.3 8.6 29.4sec 15.5sec 11.4sec 39.52% 0.00% 8.6 (8.6) 9.9

Buff Details

  • buff initial source:destruction
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 60.3s
  • trigger_min/max:2.4s / 57.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:39.52%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.0 28.7sec 14.9sec 11.7sec 41.19% 0.00% 9.0 (9.0) 10.2

Buff Details

  • buff initial source:NF_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.1s
  • trigger_min/max:2.4s / 41.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.19%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.4 9.1 28.8sec 14.9sec 11.7sec 41.18% 0.00% 9.1 (9.1) 10.1

Buff Details

  • buff initial source:NF_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 41.9s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:41.18%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.1 28.7sec 14.9sec 11.6sec 41.07% 0.00% 9.1 (9.1) 10.1

Buff Details

  • buff initial source:NF_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.07%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.0 28.6sec 14.9sec 11.6sec 41.19% 0.00% 9.0 (9.0) 10.2

Buff Details

  • buff initial source:NF_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.0s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.5s

Stack Uptimes

  • roaring_blaze_1:41.19%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.5 9.0 28.8sec 14.9sec 11.6sec 41.02% 0.00% 9.0 (9.0) 10.1

Buff Details

  • buff initial source:NF_SoulEater
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.1s
  • trigger_min/max:2.4s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:41.02%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.3 29.7sec 15.7sec 11.4sec 39.09% 0.00% 8.3 (8.3) 9.9

Buff Details

  • buff initial source:Venthyr_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.0s
  • trigger_min/max:2.4s / 41.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.09%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.3 29.6sec 15.7sec 11.4sec 39.10% 0.00% 8.3 (8.3) 9.9

Buff Details

  • buff initial source:Venthyr_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.0s
  • trigger_min/max:2.4s / 41.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.4s

Stack Uptimes

  • roaring_blaze_1:39.10%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.3 29.8sec 15.8sec 11.4sec 38.89% 0.00% 8.3 (8.3) 9.8

Buff Details

  • buff initial source:Venthyr_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.2s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 18.2s

Stack Uptimes

  • roaring_blaze_1:38.89%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.3 29.7sec 15.8sec 11.4sec 38.84% 0.00% 8.3 (8.3) 9.8

Buff Details

  • buff initial source:Venthyr_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 42.2s
  • trigger_min/max:2.4s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:38.84%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.2 8.4 29.7sec 15.7sec 11.4sec 39.00% 0.00% 8.4 (8.4) 9.8

Buff Details

  • buff initial source:Venthyr_CataOrigin
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 59.5s
  • trigger_min/max:2.4s / 59.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.2s

Stack Uptimes

  • roaring_blaze_1:39.00%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 6.8 27.0sec 16.3sec 10.7sec 39.74% 0.00% 6.8 (6.8) 10.7

Buff Details

  • buff initial source:Kyrian_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.2s
  • trigger_min/max:2.4s / 66.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.74%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.1 6.8 27.0sec 16.3sec 10.7sec 39.68% 0.00% 6.8 (6.8) 10.7

Buff Details

  • buff initial source:Kyrian_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 66.3s
  • trigger_min/max:2.4s / 66.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.68%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.0 6.9 27.2sec 16.2sec 10.7sec 39.76% 0.00% 6.9 (6.9) 10.7

Buff Details

  • buff initial source:Kyrian_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.1s / 43.9s
  • trigger_min/max:2.4s / 42.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.76%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.0 6.8 27.1sec 16.3sec 10.7sec 39.63% 0.00% 6.8 (6.8) 10.7

Buff Details

  • buff initial source:Kyrian_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 65.5s
  • trigger_min/max:2.4s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.7s

Stack Uptimes

  • roaring_blaze_1:39.63%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 11.0 6.9 27.1sec 16.3sec 10.7sec 39.72% 0.00% 6.9 (6.9) 10.7

Buff Details

  • buff initial source:Kyrian_SoulTithe
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 62.2s
  • trigger_min/max:2.4s / 57.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.6s

Stack Uptimes

  • roaring_blaze_1:39.72%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.0 9.8 30.1sec 14.7sec 12.2sec 41.28% 0.00% 9.8 (9.8) 9.7

Buff Details

  • buff initial source:Necro_AshenRemains
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.28%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.1 9.7 29.9sec 14.7sec 12.1sec 41.30% 0.00% 9.7 (9.7) 9.8

Buff Details

  • buff initial source:Necro_CombustingEngine
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 42.2s
  • trigger_min/max:2.4s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.30%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.1 9.7 29.8sec 14.7sec 12.1sec 41.27% 0.00% 9.7 (9.7) 9.8

Buff Details

  • buff initial source:Necro_DuplicitousHavoc
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.2s

Stack Uptimes

  • roaring_blaze_1:41.27%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.1 9.8 29.9sec 14.6sec 12.2sec 41.43% 0.00% 9.8 (9.8) 9.8

Buff Details

  • buff initial source:Necro_InfernalBrand
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.9s / 42.1s
  • trigger_min/max:2.4s / 39.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.43%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Conflagrate (roaring_blaze) 10.1 9.7 30.0sec 14.7sec 12.2sec 41.32% 0.00% 9.7 (9.7) 9.8

Buff Details

  • buff initial source:Necro_FatalDec
  • cooldown name:buff_roaring_blaze
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.8s / 42.0s
  • trigger_min/max:2.4s / 40.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.3s

Stack Uptimes

  • roaring_blaze_1:41.32%

Spelldata

  • id:265931
  • name:Conflagrate
  • tooltip:Fire damage taken increased by $s1%.
  • description:{$@spelldesc205184=Conflagrate increases your {$?s6353=false}[Soul Fire, ][]{$?s196447=false}[Channel Demonfire, ][]Immolate, Incinerate, and Conflagrate damage to the target by $265931s1% for {$265931d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
enemy2 Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 618
Mean 57717.62
Minimum 55185.03
Maximum 60756.56
Spread ( max - min ) 5571.53
Range [ ( max - min ) / 2 * 100% ] 4.83%
Standard Deviation 1248.3921
5th Percentile 55915.05
95th Percentile 59996.72
( 95th Percentile - 5th Percentile ) 4081.67
Mean Distribution
Standard Deviation 50.2177
95.00% Confidence Interval ( 57619.20 - 57816.05 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1798
0.1 Scale Factor Error with Delta=300 13305
0.05 Scale Factor Error with Delta=300 53217
0.01 Scale Factor Error with Delta=300 1330411
HPS
enemy2 Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 18640933 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
32571.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 57.2sec 13.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 151.7s

Stack Uptimes

  • Health Decade (0 - 10)_1:13.14%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 28.5sec 8.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 46.8s

Stack Uptimes

  • Health Decade (10 - 20)_1:8.52%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 28.1sec 9.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 47.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.50%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 27.3sec 9.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.8s / 41.6s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.32%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.4sec 11.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.2s / 44.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.37%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.6sec 13.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.6s / 50.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:13.14%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.6s / 48.1s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.85%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 31.8sec 10.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:11.5s / 47.9s

Stack Uptimes

  • Health Decade (70 - 80)_1:10.84%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 15.2sec 5.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.4s / 26.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:5.19%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 25.4sec 6.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.8s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:6.24%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 618
Mean 297.57
Minimum 240.13
Maximum 359.98
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 20.14%
DPS
enemy3 Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 618
Mean 34565.44
Minimum 32886.04
Maximum 36427.85
Spread ( max - min ) 3541.81
Range [ ( max - min ) / 2 * 100% ] 5.12%
Standard Deviation 816.1592
5th Percentile 33298.49
95th Percentile 35811.56
( 95th Percentile - 5th Percentile ) 2513.06
Mean Distribution
Standard Deviation 32.8307
95.00% Confidence Interval ( 34501.09 - 34629.79 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2142
0.1 Scale Factor Error with Delta=300 5687
0.05 Scale Factor Error with Delta=300 22746
0.01 Scale Factor Error with Delta=300 568635
HPS
enemy3 Healing Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 618
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 44
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 12133199 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.